KEGG   Burkholderia sp. KJ006: MYA_0763Help
Entry
MYA_0763          CDS       T02110                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
buk  Burkholderia sp. KJ006
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:buk00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:buk00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:811681..812232
Genome map
AA seq 183 aa AA seqDB search
MAIQVTATALPEVKIIEPKVFGDARGFFYESFNEKEFAEQVEAGVEFVQDNHSRSSKGVL
RGLHYQIQHAQGKLVRVVEGEVFDVAVDIRQHSPNFGKWVGVILSNDNHRQLWVPPGFAH
GFVVLSDAAQFLYKTTDYWFPEHERSIAWNDPAIGVKWPIDFEPLLAAKDAAGKRLSEAE
VYA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaagtaacggcgacggcgctgcccgaagtcaagatcatcgagccgaaggtg
ttcggcgatgcgcgcgggttcttctacgaaagcttcaacgagaaagaattcgccgagcag
gtcgaagccggcgttgaattcgtgcaggacaatcattcgcggtcgtcgaagggtgtgctg
cgcgggctgcactaccagatccagcacgcgcagggcaaactcgtgcgcgtcgtcgaaggc
gaagtattcgacgtcgcggtcgatattcgccagcattcgccgaacttcggcaagtgggtg
ggcgttatcctgtcgaacgacaatcatcgtcagctatgggtgccacctgggttcgcgcac
ggtttcgtcgtgctgtcggacgcagcgcaattcctttacaagacgactgattactggttt
ccggaacacgagcgcagcatcgcgtggaacgatccggcgatcggggtcaaatggcccatc
gatttcgagccgctgctggccgcgaaggacgcggcgggtaagcgtttgagcgaagctgaa
gtctatgcgtga

DBGET integrated database retrieval system