KEGG   Burkholderia sp. KJ006: MYA_0806Help
Entry
MYA_0806          CDS       T02110                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
buk  Burkholderia sp. KJ006
Brite
Enzymes [BR:buk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MYA_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 PrmA MTS RrnaAD Methyltransf_11 Methyltransf_18 Met_10 Ubie_methyltran Methyltransf_12 Methyltransf_23 Spermine_synth TPMT Methyltr_RsmB-F Methyltransf_32 UPF0146 Eno-Rase_NADH_b DUF938
Motif
Other DBs
NCBI-ProteinID: AFJ85173
UniProt: I2DKJ7
Position
1:complement(869466..870122)
Genome map
AA seq 218 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDLDVLGLLSIVKRENYVLPEHRDLAFADLELPLPGGTSK
MLFPRVEARVLQDLAVKKHENVLVIGAGSGYLAALFAHRAQHVTAVDIDPTIAKFAADNL
RNDGVTNAEVVLGDGSLGWPAKAPYDVICVAGGLPVVPQQMLEQLKVGGRLSAFVGGRPV
MKAQIITRIDDKQYRVADVFETYVNHLVNAIEPSRFKF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacgcgcgtttcaacatgatcgaacaacagatccggccgtgggacgtg
ctggacctggacgtcctgggcctgctgtcgatcgtcaagcgagaaaactacgttctgccc
gaacaccgcgatctggcgttcgccgatctcgaactgccgctgccgggcggcaccagcaag
atgctgttcccgcgcgtcgaagcgcgcgtgctgcaggatctggcggtcaagaagcacgag
aacgtcctcgtgatcggtgcgggctccggctacctggccgcgctgttcgcgcatcgcgcg
cagcacgtgacggcggtcgacatcgatccgacgatcgcgaagttcgcagccgacaacctg
cgcaacgacggcgtgacgaacgccgaagtcgtgctcggcgacggctcgctcggctggccc
gccaaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcagcag
atgctcgaacagctgaaggtcggcggccgcctgtcggcattcgtcggcggccgtccggtg
atgaaggcgcagatcatcacgcgcatcgacgacaagcagtaccgcgtcgccgacgtgttc
gaaacctacgtgaaccacctcgtgaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system