KEGG   Burkholderia sp. KJ006: MYA_0852Help
Entry
MYA_0852          CDS       T02110                                 

Definition
glucokinase / HTH-type Transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYA_0852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_0852
   00052 Galactose metabolism
    MYA_0852
   00500 Starch and sucrose metabolism
    MYA_0852
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_0852
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYA_0852
   00524 Butirosin and neomycin biosynthesis
    MYA_0852
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MYA_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(905271..907199)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIR
KYLKDVKIARVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGIEIIYRALAARDKKRVAASVDTADIVERAHA
GEALALETVECFCGILGSFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFAHYLQNIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAS
TAGELPEAVAQARARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggccgtcgtcgcgggtcagcatgccgacggcccgcgc
ctgctcgcggatgtcggcggcaccaacgcgcgtttcgcgctggaaaccggcccgggtgag
atcacgcagatccgcgtctatccgggcgccgattatccgacgctcaccgacgcgatccgc
aagtatctgaaggacgtgaagatcgcccgcgtgaaccacgcggcgatcgcgatcgcgaac
ccggtcgacggcgaccaggtcacgatgaccaaccacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctcgtcgtcaacgacttcaccgcgctcgcg
atggcgctgcccggcctcaccgatgcgcagcgcgtgcagatcggcggcggcacgcggcgc
cagaacagcgtgatcgggctgctcggcccgggcaccgggctcggcgtgtcgggcctgatc
ccggcggacgaccgctggatcgcgctcggcagcgaaggcggccacgcttcgttcgcgccg
caggacgagcgcgaggatctcgtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgagcgggtgtgcgcgggccccggcatcgagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcgtcgccgcgagcgtcgacacggccgacatcgtcgagcgcgcgcacgcg
ggcgaagcactcgcgctcgagacggtcgaatgcttctgcggcattctcggctcgttcgcg
ggcagcgtcgcgctcacgctcggcgcgctcggcggcgtctacatcggcggcggcgtcgcg
ctcaagctcggcgagctgttcacgcgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgcttcgcgcactatctgcagaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtgtcggcgatcctcgcggagcagttgtcgaaccgctcgggcggtgcgtcg
tcggcggtgttcgagcggattcgccagatgcgcgacgcgctgacgccggccgagcgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgacccgatcgtcgatatc
gcgcgcaaggccgacgtgagccagccgacggtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgcgaccggcctcaccggcacgattccgatg
agccacagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtcggcgatcctgcaactgcgcgaacacctgaacttcgagcacgtcgagaac
gcgatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaactcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcctac
ggcgacctgtacatgcaggccgcgtcggcggcgctgctcggcaagggggacgtgatcgtc
gcggtgtcgaaatcggggcgcgcgcccgagctgctgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacatcgagcaacacgccgctcgcgaagcgcgcaacc
gtggcgctcgaaaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctggtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgcgtcg
accgccggcgaactgccggaagctgtcgcgcaggcgcgtgcgcgcgcgagcgacgacgaa
acggccgacgtgctcgactggctgagccacggcgcgtcgccggcggcgaaggacgtcgcg
cgcgactga

DBGET integrated database retrieval system