KEGG   Burkholderia sp. KJ006: MYA_0889Help
Entry
MYA_0889          CDS       T02110                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
buk  Burkholderia sp. KJ006
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYA_0889
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MYA_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:941046..941729
Genome map
AA seq 227 aa AA seqDB search
MTDSHRDGHASHALHGGVYPGNLFMVIAPSGAGKSTLVNALLSKDSDICLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMASGHDVLLEIDW
QGAQQVKRQFHNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEMAHASEAEY
VVINENFDRALAELECIVAATRLRFGSQYARHAELFIELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcccatcgcgacggccacgcgtcgcacgcgctgcacggcggcgtctatccc
ggcaacctgttcatggtcatcgcgccgtcgggcgccggcaagtcgacgctcgtgaacgcg
ctgctgtcgaaggacagcgacatctgcctgtcgatttcgtacacgacgcgcaagccgcgc
ccgggcgagcaggacggccagcactatcacttcaccaccgtcgaggatttccgcgcgcgt
cacgccgcgcacgaattcctcgaaagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtgtggatcgaggagcagatggcgagcggccacgacgtgctgctcgagatcgactgg
cagggcgcgcagcaggtgaagcggcagtttcacaacgcggtcggcatcttcatcctgccg
ccatcgctcgatgcgctcgaggagcgtctgaagaagcgcggccaggacgagccgaacgtc
atcacgcgacgcctgctcgcggccggcagcgagatggcgcacgcgtccgaagcggaatac
gtggtgatcaacgagaatttcgatcgtgcgctcgcggaactggagtgcatcgtcgcggcg
acgcgcctgcgttttggttcgcagtacgcgcgacatgcggagctgttcatcgaactcggc
atccatctgccccacgcggaatga

DBGET integrated database retrieval system