KEGG   Burkholderia sp. KJ006: MYA_1033Help
Entry
MYA_1033          CDS       T02110                                 

Definition
Beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
buk  Burkholderia sp. KJ006
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_1033
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MYA_1033
Enzymes [BR:buk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYA_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1085910..1086938
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFENRAQLSALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDAILEDDVAPYDWLGLSLSAVIPAHVIYTQVDPRPAGFSRVWLQDIL
RGRLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNELSAR
PSPESVRRIKRMRARGKALKWDKLIAQPEYLQARGLLTSVLA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcgcgcgac
gatgcgcggcgccttgcgcatccgaacaccggcggcgtgatcctgttcgcgcggcatttc
gaaaaccgcgcgcagctgagcgcgttgaccgactcgatccgcgcggtgcgcgaggacatc
ctgatcgcggtcgatcacgaaggcggccgcgtccagcggttccgcaccgacggcttcacg
gtgctgccggcgatgcgccggctcggcgagctgtgggatcgcgacgtgctgctcgcgacc
aaggtcgccaccgcggtcggctacatcctcgccgccgagctgcgcgcctgcgggatcgac
atgagcttcacgcccgtgctcgatctcgactacggacattcgaaggtgatcggcgatcgc
gcgttccatcgcgacccgcgcgtcgtcacgttgctcgcgaagagcctgaaccacgggctg
tcgctcgcgggcatggccaactgcggcaagcatttccccgggcatggtttcgcggaagcc
gattcacacgtcgcgctgccgaccgacgaccggccgctcgacgcgatcctcgaggacgac
gtcgcgccgtacgactggctcggcctgtctctgtcggcggtgattcccgcgcacgtgatc
tatacgcaggtcgacccgcggccggccggcttctcgcgcgtgtggctgcaggacatcctg
cgcgggcggctcggtttcacgggcgcgatcttcagcgacgacctgtcgatggaggccgcc
cgcgaaggcggcacgctcacgcaggccgccgacgcggcgctcgcggccggctgcgacatg
gtgctcgtctgcaaccagccggaggccgccgaagtcgtgctgaacgaactgagcgcgcgg
ccgtcgccggagtcggtgcggcgcatcaagcggatgcgtgcgcgcggcaaggcgctcaag
tgggacaagctgatcgcgcagcccgagtatctgcaggcgcgcgggctgttgaccagcgtg
ctcgcataa

DBGET integrated database retrieval system