KEGG   Burkholderia sp. KJ006: MYA_1103Help
Entry
MYA_1103          CDS       T02110                                 

Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
buk  Burkholderia sp. KJ006
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:buk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYA_1103
Enzymes [BR:buk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MYA_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1176616..1178940
Genome map
AA seq 774 aa AA seqDB search
MNASDDTLEFTGGLVARLPEPADFGIALAEGFARRIGELSRRAGAPAAAARWAARAAFAA
SRATAGGHVCVALGALAHRYDEPVDDVRAALAASGLVAYGTLERGDERPLIVDRHDRLYL
SRYFDYERRLAEALVAQADAAAPDDALSSERLRASLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAQPGLRIALAAPTGKAAQRMQEALHARSGDLPPE
LAARLPETSYTLHRLLGGGGSTGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPTFSAAARTRIAAALGIAEGAFAVALPVPDGDA
ANAVAAVAPVSTSAPAPAPAPDRTVPHAAASTARKPSTRRSADPRQASLFDDAPQAEADV
PDPAVPSAASAPPGGPTATERPIGDPAWIEADELAWLDAVELAPFEPGDAETAALASAAA
SLAVGADTAPPALAPAPLADCVVWLERNYRFGLDSPIGRLSLAIRRGDVQAALDALPADD
AAAASFHDDAGDTLAPSTVERLARRFGAYLAALRTALSETVPDPLPLFDALNRFRILCAT
RTGSRGAEHVNALVAAHVRQAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPD
AQGVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTR
ELVYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRTETSR
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgtccgacgacacgctcgaattcaccggtggcctggttgcgcgcctgcccgag
ccggcggatttcggcatagcgctggccgagggtttcgcgcgccgcatcggcgagttgtcg
cgtcgcgcgggcgcgccggccgcggctgcgcgctgggccgcgcgcgccgcgttcgcggcg
agccgcgcgacggcgggcggccatgtgtgcgtcgcgctcggcgcgctcgcgcatcgctac
gatgagcccgtcgacgacgtgcgcgcggcgctggcagcgagcgggctggttgcctatggc
acgctcgagcgcggtgacgagcggccgctgatcgtcgaccggcacgaccggctgtatctg
tcgcgctatttcgattacgagcggcgtctcgccgaggcgctggtggcccaggccgacgcg
gccgcaccggacgacgcgctgtcttccgagcgcttgcgtgcgagcctcgcgcgttacttc
ggaccggcgaccggcgaggtcgactggcagcgcgtcgcggcgatcgtcgcgcttaccgga
cgcgtgacgatcgtcagcggcgggccgggcaccggcaagacgacgaccgtggtcggcgtg
ctcgcttgtctgctcgatgcgcagccggggcttcgcatcgcgctggccgcgcctaccggc
aaggccgcgcagcggatgcaggaagcgctgcacgcgcgctcgggcgatctcccgccggag
ctggcggcgcgcctgcccgagacgtcgtatacgctgcatcgcctgctgggcggcggcggg
tcgacgggcttccggcatcatcgcgacaatccgttgccgtacgacctgatcgtggtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgacgcgctcgcaccgggc
gcgcggctcgtgctgctcggcgacaaggaccagctcgcggccgtcgaggccggcgccgta
ttcgcggagctcagcgcgcggccgaccttcagtgccgctgcgcgcacgcgcatcgcggcg
gcgctcggcatcgccgaaggcgcgtttgctgtggcattgccggtgccggacggcgatgcg
gcgaatgcggttgctgctgtggctccggtttcgacttcagctcccgctcccgctcccgct
ccagaccgaaccgttccgcatgctgccgcgagtaccgcacgcaagccgtcgacgcggcga
agtgcggatccgcgacaggcgtcgttgttcgacgacgcgccgcaggccgaagcggatgtg
cctgatccggccgtcccgtctgcggcgtccgcaccgcctggcgggccaactgccaccgaa
cgcccgatcggcgatcccgcatggatcgaggccgacgagctcgcgtggctcgacgcggtg
gagcttgcgccattcgaaccgggtgacgctgaaacggcggcgctcgcatcggccgccgca
tcgctcgcggtcggtgccgatacagcgccgcccgcgctcgcccccgcgccgctggccgac
tgcgtcgtgtggctcgaacgcaactaccgcttcggcctcgattcgccgatcggacggctg
tcgctcgcgatccgtcgcggcgacgtgcaggccgcgctcgatgcgttgcccgccgacgat
gcggccgccgcgtcgttccatgacgacgccggcgacacgctcgcgccgtccaccgtcgag
cggcttgcacgccggttcggcgcgtacctcgctgcgttgcgcaccgcgttgtccgagacg
gtacccgatccgctgccgctgttcgatgcgctcaaccgtttccggatcctgtgcgcgacg
cgcacgggctcgcgcggcgccgagcacgtcaacgcgctggtggccgcgcatgtgcggcag
gcggcgcgcgtgccgctcgcggtcggcgcgcactggttcaccgggcggccgatcatggtg
acgcgcaacgattacgcgctcgggctgttcaacggcgacatcggcatcgcgttgcctgac
gcgcagggcgtgctgcgcgtatggttccggcgcgcggacggcaccgcgcgcgcggtgtcg
ccggccgcgttgccgccgcacgaaacggcattcgcgctgacggtccacaagtcgcagggg
tcggaattcgacgaggccgcactggtgctgccggcgtcgttcggccgcgtgctgacgcgc
gagctcgtctatacggccgtcacgcgcgcacggacgcgcgtgcaggtgatcggcccgcgg
cgcgtgctggcgcaggcggttgcgacgcgcacgcagcgcgactcggggctggcggcccgc
gtcgacgaggcgctcgcgcgccgccgcacggagacgtcacgatga

DBGET integrated database retrieval system