KEGG   Burkholderia sp. KJ006: MYA_1176Help
Entry
MYA_1176          CDS       T02110                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
buk  Burkholderia sp. KJ006
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:buk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1258488..1259381
Genome map
AA seq 297 aa AA seqDB search
MSESAVSVSAPAPLQCGRFSLTFERPLVMGILNATPDSFSDGGRFLARDDALRQAERMVA
DGVDLIDIGGESTRPGAPPVPLDEELARVIPLVEALRPLDVPLSIDTYKPAVMRAALAAG
ADLINDIWGFRQPGAIDAVRDGNCGLCAMHMLGEPQTMQVGEPDYDDVVVDVHDFLAARA
QALRDAGIAPQRICVDPGFGFGKAVIDDNYALLAALPDTAPLRPDGRAYPILAGMSRKSM
LGAVIGGKPPLERVAASVAAAVCAVARGAAIVRVHDVAATVDALKVWNAVREAARQR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaatccgcagtcagcgtatccgctcccgcgccgctccagtgcggccgcttctcg
ctcaccttcgagcgcccgctcgtgatgggcatcctcaacgccacacccgattcgttttcc
gacggcggccgcttcctcgcgcgcgacgatgcgttgcgccaggccgagcggatggttgcc
gacggcgtcgatctgatcgacatcggcggcgaatcgacgcgccccggcgcgccgcccgtg
ccgctcgacgaggagctcgcgcgcgtgatcccgctcgtcgaagcgttgcgcccgctcgac
gtgccgctgtcgatcgacacgtacaaaccggcggtgatgcgcgcggcgctcgcggccggc
gccgacctgatcaacgacatctgggggttccgacagccgggcgcgatcgatgcggtgcgc
gacggcaattgcgggttgtgcgcgatgcacatgctcggcgagccgcagaccatgcaggtg
ggcgagccggactacgacgacgtcgtcgtcgacgtgcacgactttctcgccgcgcgcgcg
caggcgctgcgcgatgcgggcatcgcgccgcagcggatctgcgtcgacccgggcttcggc
ttcggcaaggcggtgatcgacgacaactacgcgctgctggccgcgttgcccgacacggcg
ccgctgcggcccgacgggcgcgcctatccgatcctcgcgggcatgtcgcgcaagtcgatg
ctcggcgcggtgatcggcggcaagccgccgctcgagcgcgtcgcggcgagcgtggcggcg
gccgtgtgcgcggtcgcacgcggcgccgcgatcgtgcgcgtgcacgacgtggccgcgacg
gtcgatgcattgaaagtttggaacgccgtgcgcgaagccgcgcggcaacgataa

DBGET integrated database retrieval system