KEGG   Burkholderia sp. KJ006: MYA_1219Help
Entry
MYA_1219          CDS       T02110                                 

Definition
endoglucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYA_1219
Enzymes [BR:buk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MYA_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1300826..1302049
Genome map
AA seq 407 aa AA seqDB search
MVWAYATRRAARRAGAALALAAAAAAGPLHAAQDGAGAAAGSAGAAGAQCGGAAWPRWDA
FKRDFVSADGRVIDVGSDDSRTVSEGQAYGLFFALVANDRRTFDTILAWTENNLAQGDLS
AHLPAWLWGRAPDGAWRVLDANAASDADLWIAYTLVEAGRLWHERSYTARGALLAKRVLD
TETASVPGLGLTLLPGPTGFKLANGQWRVNPSYSPPQVIRGLAARLPDERRWAALMASTG
RVLLDTAPKGFAPDWALYRAGAGFGPDPQTHAESAYNAIRVYLWAGMLDRSDPLAAPLLA
RFAPFADHIAAHGAPPERVDTTTGVAAPNDGNGGFSAAAVPFLAARGQQALADAQAARVD
ALARQSPPGYYTSVLTLFGLGWRDGRYRFGADGTLDARWEGRPCAAR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggcatacgcaacacggcgggcggcgcggcgcgccggcgcggcgctcgcgctg
gccgctgccgcggcagccggcccgctgcacgcggcgcaggacggcgcgggcgcagcggcg
gggtcggccggggcggccggcgcgcaatgcggcggcgcggcgtggccgcgctgggacgcg
ttcaagcgcgatttcgtgtcggccgacggccgggtgatcgacgtcggctccgacgattcg
cgcacggtatcggaggggcaggcgtatggactgttcttcgcgctcgtcgcgaacgaccgg
cgcacgttcgacacgatcctcgcatggaccgagaacaatctcgcgcagggcgacctgagc
gcgcatctgcccgcgtggctgtggggccgcgcgccggacggcgcgtggcgcgtgctggac
gcgaacgcggcgtcggacgccgacctgtggatcgcgtacacgctcgtcgaagccggcagg
ctgtggcacgagcgcagctacaccgcgcgcggtgcgctgctcgcgaagcgcgtgctcgac
accgagacggccagcgtgccgggcctcggcctcacgctgctgcccggcccgaccggcttc
aagctagcgaacgggcaatggcgcgtgaacccgagctattcgccgccgcaggtgatccgc
gggctcgccgcccgcctgcccgacgagcgccgctgggccgcgctgatggcgagcaccggc
cgcgtgctgctcgacaccgcaccgaagggcttcgcgccggactgggcgctgtatcgcgcg
ggcgccggcttcggccccgatccgcagacccacgcggaaagcgcgtacaacgcgattcgc
gtgtacctgtgggccggcatgctggatcgcagcgatccgctcgccgcgccgctgctcgcg
cgtttcgcgccgttcgccgaccacatcgccgcgcatggcgcgccgccggagcgggtcgac
acgaccaccggcgtcgccgcgccgaacgacggcaacggcggcttctccgcggcggccgtg
ccgttcctcgccgcgcgcggccagcaggcgctcgccgatgcgcaggccgcgcgggtcgat
gcgctcgcgcgccagtcgccgcccggctattacacgagcgtgctgacgctgttcggcctc
ggctggcgcgacggtcgctaccggttcggcgccgacgggacgctcgacgcgcgctgggag
ggccgtccatgcgcggcacgatga

DBGET integrated database retrieval system