KEGG   Burkholderia sp. KJ006: MYA_1219Help
Entry
MYA_1219          CDS       T02110                                 

Definition
endoglucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
buk  Burkholderia sp. KJ006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:buk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1300826..1302049
Genome map
AA seq 407 aa AA seqDB search
MVWAYATRRAARRAGAALALAAAAAAGPLHAAQDGAGAAAGSAGAAGAQCGGAAWPRWDA
FKRDFVSADGRVIDVGSDDSRTVSEGQAYGLFFALVANDRRTFDTILAWTENNLAQGDLS
AHLPAWLWGRAPDGAWRVLDANAASDADLWIAYTLVEAGRLWHERSYTARGALLAKRVLD
TETASVPGLGLTLLPGPTGFKLANGQWRVNPSYSPPQVIRGLAARLPDERRWAALMASTG
RVLLDTAPKGFAPDWALYRAGAGFGPDPQTHAESAYNAIRVYLWAGMLDRSDPLAAPLLA
RFAPFADHIAAHGAPPERVDTTTGVAAPNDGNGGFSAAAVPFLAARGQQALADAQAARVD
ALARQSPPGYYTSVLTLFGLGWRDGRYRFGADGTLDARWEGRPCAAR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgggcatacgcaacacggcgggcggcgcggcgcgccggcgcggcgctcgcgctg
gccgctgccgcggcagccggcccgctgcacgcggcgcaggacggcgcgggcgcagcggcg
gggtcggccggggcggccggcgcgcaatgcggcggcgcggcgtggccgcgctgggacgcg
ttcaagcgcgatttcgtgtcggccgacggccgggtgatcgacgtcggctccgacgattcg
cgcacggtatcggaggggcaggcgtatggactgttcttcgcgctcgtcgcgaacgaccgg
cgcacgttcgacacgatcctcgcatggaccgagaacaatctcgcgcagggcgacctgagc
gcgcatctgcccgcgtggctgtggggccgcgcgccggacggcgcgtggcgcgtgctggac
gcgaacgcggcgtcggacgccgacctgtggatcgcgtacacgctcgtcgaagccggcagg
ctgtggcacgagcgcagctacaccgcgcgcggtgcgctgctcgcgaagcgcgtgctcgac
accgagacggccagcgtgccgggcctcggcctcacgctgctgcccggcccgaccggcttc
aagctagcgaacgggcaatggcgcgtgaacccgagctattcgccgccgcaggtgatccgc
gggctcgccgcccgcctgcccgacgagcgccgctgggccgcgctgatggcgagcaccggc
cgcgtgctgctcgacaccgcaccgaagggcttcgcgccggactgggcgctgtatcgcgcg
ggcgccggcttcggccccgatccgcagacccacgcggaaagcgcgtacaacgcgattcgc
gtgtacctgtgggccggcatgctggatcgcagcgatccgctcgccgcgccgctgctcgcg
cgtttcgcgccgttcgccgaccacatcgccgcgcatggcgcgccgccggagcgggtcgac
acgaccaccggcgtcgccgcgccgaacgacggcaacggcggcttctccgcggcggccgtg
ccgttcctcgccgcgcgcggccagcaggcgctcgccgatgcgcaggccgcgcgggtcgat
gcgctcgcgcgccagtcgccgcccggctattacacgagcgtgctgacgctgttcggcctc
ggctggcgcgacggtcgctaccggttcggcgccgacgggacgctcgacgcgcgctgggag
ggccgtccatgcgcggcacgatga

DBGET integrated database retrieval system