KEGG   Burkholderia sp. KJ006: MYA_1347Help
Entry
MYA_1347          CDS       T02110                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00310  Lysine degradation
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_1347
  Amino acid metabolism
   00310 Lysine degradation
    MYA_1347
Enzymes [BR:buk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYA_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFJ85710
UniProt: I2DM34
Position
1:1448032..1449252
Genome map
AA seq 406 aa AA seqDB search
MLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQVLQNDGDTVVADQVIATIDT
EAKAGAAQAAAGAAEVQPAAAPAAAAPAAQPAAATASSSAAASPAAAKLLAEKGLSTGDV
AGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPEVKVPASATTWLNDRPEQRV
PMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKFEKEHGVKLGFMSFFV
KAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQLSLAEIEKKI
AEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVEN
GQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaa
ctcgagaccgacaaggtcgtgctcgaagtgccggcaccggccgcgggcgtgctcgcacaa
gtgctgcagaacgacggtgacaccgtggtcgccgatcaagtgatcgcgacgatcgacacc
gaagcgaaggcaggtgctgcgcaagccgcagcgggcgccgcggaagtgcagccggcggca
gcgccggccgcagcagcaccggccgcacagccggctgccgcaacggcatcgagctcggcc
gccgcatcgccggccgcagcgaagctgctggccgagaagggtctgtcgacgggcgacgtc
gcaggctcgggccgcgacggccgcgtcacgaagggcgacgcgctcgccgcaggcagcgca
ccgaaggctgcaccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccg
gaagtgaaggtcccggcatcggccacgacctggctgaacgaccgtccggaacagcgcgtg
ccgatgtcgcgcctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaaacgaac
gcgatcctgacgacgttcaacgaagtcaacatgcagccggtcatggaccttcgcgcgaag
tacaaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtg
aaggcggccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaac
gacatcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtcgtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatc
gccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggt
acgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaac
ccgccgcagtcggcgatcctcggcgtgcacgcgacgaaggaacgtccggtcgtcgagaac
ggccagatcgtgatccgtccgatcaactacctcgcgctgtcgtacgaccaccgcatcatc
gacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctcgaagatccggca
cgtctgctgctcgacctgtaa

DBGET integrated database retrieval system