KEGG   Burkholderia sp. KJ006: MYA_1483Help
Entry
MYA_1483          CDS       T02110                                 

Definition
cobalamin biosynthesis protein ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYA_1483
Enzymes [BR:buk01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MYA_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1605272..1606360
Genome map
AA seq 362 aa AA seqDB search
MTDPTMQRTRAVFPFAALVAQEPLQQALLLAAIDPALGGVLVSGPRGTAKSTAARALAEL
LPEGEFVTLPLSASDEQVTGTLDLAHALAENGVRFRPGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRAQIVKARLAFDGDPDAFRARHADAQRALAERIRAARQRLAALDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEQAAAVTVSHVERVADAVLRHRRHADAPRAPDASPS
RDDGARDGRAPPDPHSRRDERGGAHAAGGAAPSPDGDWGYLPPEPAGLHDVKGVVPLPLK
KR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgaccatgcagcgcacgcgcgcggtgttcccgttcgcggcgctggtcgcg
caagagccgctgcagcaggcgctgctgctcgcggcgatcgacccggcgctcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaagtcgaccgccgcacgcgcgctcgcggaattg
ctgccggaaggcgaattcgtcacgctgccgctgtcggccagcgacgagcaggtgaccggc
acgctcgatctcgcgcacgcgctcgccgagaacggcgtgcgctttcggcccggcctgctc
gcgcgcgcgcatcgcggcgtgctgtacgtcgacgaggtcaacctgctggccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacgtggtcgagcgcgatggcgtg
tcgcacgcgcacgacgcgcgcttcgtgctggtcggcacgatgaatcccgaggaaggcgag
ctgcgcccgcagctgctcgatcgcttcgggctgatggtcgagctcgagaactgtttcgac
gccgcgcagcgcgcgcagatcgtgaaggcgcggctcgcgttcgacggcgaccccgacgcg
ttccgggcgcgtcacgcggatgcgcagcgcgcgctcgccgagcgcattcgcgcggcgcgg
caacggctcgccgcgctggatttcgacgacgcggtgcacgcgcgcgtgagcgcgctgtgc
atcgacgcggccgtcgacgggctgcgcgcggacctcgtgatgctgcgcgccgcgcgcgca
ctcgcggcgctcgaacaggccgccgcggtgacggtgtcgcacgtcgaacgcgtggccgac
gcggtgctgcgccaccggcgtcatgcggatgcgccgcgcgcgccggatgcatcgccgtcg
cgcgacgacggcgcacgcgacggccgtgcgccgccggacccgcattcgcggcgcgacgag
cgcgggggcgcgcacgcggcgggcggcgctgcgccgtcgcccgatggcgactggggctat
ctgccgcccgagccggccggattgcacgacgtgaagggcgtggtgccgctgccgctaaaa
aaacgctga

DBGET integrated database retrieval system