KEGG   Burkholderia sp. KJ006: MYA_1613Help
Entry
MYA_1613          CDS       T02110                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
buk  Burkholderia sp. KJ006
Brite
Enzymes [BR:buk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MYA_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1738005..1738934)
Genome map
AA seq 309 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSDGRAGERHAAIAAPKAADKPAAVPKPVALKPGVARMP
PGTAAAKPATALKPTVPKPAMPKPIAANAAPAGAFALTSERVRERMVERLRANGVTDPRV
LDAMAAVPRHLFVDAGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLEI
GTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAPF
DAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQPQVLTLIERVAHAQWRESRLDRVF
FVPLKSGVI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggtttccgctcgcgctcgaagatctcaagcgagcgcca
cgcaaatccgacggtcgggccggcgaacgccatgcggcaatcgcggcgccgaaggccgcc
gacaagccagccgccgtgccgaagccggtcgcgctgaagcccggtgtcgcgcgcatgccg
cccggcacggccgccgcgaagccggccaccgcgctgaagccgaccgtgccgaagcccgcg
atgcccaagccgatcgccgcgaacgccgcgccggccggcgcgttcgcgctcacgtcggaa
cgcgtgcgcgagcgcatggtcgaacgcctgcgcgcgaacggcgtgaccgatccgcgcgtg
ctggacgcgatggcggcggtgccgcgccatctgttcgtggacgcgggcctcgcgacgcag
gcctacgaagattccgcgttgccgatcggccatcagcaaaccatttcaaagccgtcggtg
gtcgcgcgcatgatcgagctcgcgatggccggccgcacgctcgagcgcgtcctcgagatc
ggcaccggttgcggctatcaggccgccgtgctgagccacgtggcgcgcgacgtgtattcg
attgaacgcatcaagccgctctacgagcgcgccaagctgaacctgcggccgctgcgcgtg
ccgaacatccgtctgcactacggcgacgggcgggtcgggctgccatccgcagcgccgttc
gacgcgatcgtgatcgcggcggccgggctcgacgtgccgcaggcgctgctcgagcagctc
gcgatcggcggccggctcgtcgcgccggtcggcgcgcagagcgggcagccccaggtgctc
acgctgatcgagcgcgtcgcgcacgcgcagtggcgggagtcgcggcttgatcgcgttttc
tttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system