KEGG   Burkholderia sp. KJ006: MYA_1616Help
Entry
MYA_1616          CDS       T02110                                 

Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
buk  Burkholderia sp. KJ006
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:buk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1741201..1741797)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSSLVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtcctcgctcgtcgaagcgctgcgcgcgctgcccggcgtc
gggccgaagtccgcgcagcgcatcgcgtatcacctgatgcagcacgatcgggagggcgcc
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaggcgcagatctgcgaggtgtgcagcgacgacgagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcccgccgaccagatcatgctcgagcagacgatgacgtac
cgcgggctgtacttcgtactgatggggcgactgagcccgctcgacgggatcggcccgaaa
gaaatccacttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagcgaccgcccattacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcacgcggcgtgccggtgggcggcgagctc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcacgatgtag

DBGET integrated database retrieval system