KEGG   Burkholderia sp. KJ006: MYA_1630Help
Entry
MYA_1630          CDS       T02110                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00020  Citrate cycle (TCA cycle)
buk00620  Pyruvate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_1630
   00020 Citrate cycle (TCA cycle)
    MYA_1630
   00620 Pyruvate metabolism
    MYA_1630
Enzymes [BR:buk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYA_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Thioesterase Abhydrolase_5 Esterase PGAP1 Ser_hydrolase Ndr DUF900 Abhydrolase_8 DUF915 Abhydrolase_3 DUF676 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AFJ85991
UniProt: I2DMW5
Position
1:complement(1755064..1756179)
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKSIGERVTKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAADASDADIDAAIAEFQRDFVPSAAADDAAGPQPEKAQIGGR
TLRFLKLGDGSGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVETGS
LDELADAVLALLDAQQIERAHLIGHSMGGAVAMAAAERAPQRVASLTLIASAGLGADINR
DYIDGFVAGNSRNTLRPHLGALFADHALVTRQLVEDLVKYKRLEGVQAALEKIANAAFDG
AAQRRVFRDRVASLAPRTLVIWGEHDQVIPAQHAQGLPDGVRAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaagtgggggctgtcgatggagcaggggcaggtc
aatggctggctgaagtcgatcggcgagcgcgtgacgaagggcgacgaagtgctcgacgtg
gagaccgacaagatctcgtcgggcgtcgagtgcgcgttcgacggcacgctgcgccggcaa
gtcgcgcaggaaggcgagacgctgccggtcggcgcgctgctcggcgtggtcgccgcagct
gatgcgagcgacgccgacatcgacgcggcgatcgccgaattccagcgcgatttcgtgccg
agcgcggccgccgacgacgcggccggcccgcagcccgagaaggcgcagatcggcgggcgc
acgctgcggttcctgaagctcggcgacggctcgggcacgccggccgtgctgattcacggc
ttcggcggcgatctgaacaactggctgttcaatcacgcggaactcgccgcgcatcggccg
gtgtgggcgctcgacctgccggggcacggcgagtccggcaaggcggtcgagaccggcagc
ctcgacgaactcgccgacgcggtgctcgcgctgctcgatgcgcagcagatcgagcgcgcg
cacctgatcggccattcgatgggcggcgcggtggcgatggcggcggccgagcgcgcgccg
caacgcgtggcgtcgctgacgctgatcgcgagcgccgggctcggcgccgacatcaaccgc
gattacatcgacggcttcgtcgcgggcaacagccgcaacaccctgaggccgcatctcggc
gcgctgttcgcggatcacgcgctggtgacgcggcaactggtcgaggatctcgtcaagtac
aagcggctcgaaggcgtgcaggcggcgctcgagaagatcgcgaacgcggcgttcgacggc
gcggcccagcggcgcgtgttccgcgatcgcgtcgcgtcgctcgcgccgcgtacgctggtg
atctggggcgagcacgaccaggtgattcccgcgcagcacgcgcagggcttgccggacggc
gtgcgcgccgaggtgatcgccggcagcggccacatggtgcagatggaggcggctgccgac
gtgaaccgcctgatcgtcgcgtttctcggagactga

DBGET integrated database retrieval system