KEGG   Burkholderia sp. KJ006: MYA_1646Help
Entry
MYA_1646          CDS       T02110                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00260  Glycine, serine and threonine metabolism
buk00750  Vitamin B6 metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01230  Biosynthesis of amino acids
Module
buk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYA_1646
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MYA_1646
Enzymes [BR:buk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MYA_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFJ86007
UniProt: I2DMY1
Position
1:complement(1771623..1773074)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPQVSADELARWRTLPYADLAFEI
LTKFCDDVPADDLRAITRRTYTAAVYSNTRHGENACDITPLKPLGTEQGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGEALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
RKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKARHKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGVYRVRSAQNTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVDEKG
GFDLAASGDFARVAQFGFVSGRSSHADRIATIRDVFARYDTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALEREAERPAAFDGLEALPQRFDVVKADAQQVKDFIAAH
TDA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccacacgttttccgacatc
ctgctcggcggcctcgcgaaggacggcgggctgtacctgccgagcgagtatccgcaggtg
tcggcagacgagctcgcgcgctggcgcacgctgccgtatgcggatctcgcgttcgagatc
ctcacgaaattctgcgacgacgtgcccgccgacgacctgcgtgcgatcacgcgccgcacc
tacacggccgccgtctacagcaacacgcgccacggcgagaacgcgtgcgacatcacgccg
ctgaagccgctcggcaccgagcagggcacggcgctgtcgctgctcgagctgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgaagcgctgaacattctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
cgcaagatgagcgcgttccagaccgcgcagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgagggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcccggcacaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtctattacttcaagggctatttcgcggccacccggtccaacgac
gagcgcgtctcgttcacggtgccgtcgggcaacttcggcaacgtctgcgccggccacatc
gcgcgcatgatggggctgccgatcgcgaagctggtcgtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgtctaccgcgtgcgcagcgcgcagaacacctatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggtcgcgatccggcgcgcgtgatgcagctgttccgcgacgtcgacgagaagggc
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgcgcagttcggcttcgtgtcc
ggccgcagcagccatgcggaccgcatcgcgacgatccgcgacgtgttcgcccgttacgac
acgatgatcgacacccatacggccgacggcgtgaaggtcgcgcgcgagcacctcgacgcc
ggcgtgccgatggtcgtgctcgagacggcgcagccgatcaagttcggcgagacgatccgc
gaagcgctcgagcgcgaggccgaacggccggccgcgttcgacgggctcgaagcgctgccg
caacgcttcgacgtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcgcac
acggacgcgtaa

DBGET integrated database retrieval system