KEGG   Burkholderia sp. KJ006: MYA_1648Help
Entry
MYA_1648          CDS       T02110                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00220  Arginine biosynthesis
buk00250  Alanine, aspartate and glutamate metabolism
buk00290  Valine, leucine and isoleucine biosynthesis
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01130  Biosynthesis of antibiotics
buk01210  2-Oxocarboxylic acid metabolism
buk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYA_1648
   00290 Valine, leucine and isoleucine biosynthesis
    MYA_1648
   00220 Arginine biosynthesis
    MYA_1648
Enzymes [BR:buk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MYA_1648
    2.6.1.66  valine---pyruvate transaminase
     MYA_1648
Amino acid related enzymes [BR:buk01007]
 Aminotransferase (transaminase)
  Class I
   MYA_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AFJ86009
UniProt: I2DMY3
Position
1:complement(1774471..1775709)
Genome map
AA seq 412 aa AA seqDB search
MKPIQKSNKLLNVCYDIRGPVLEHAKRLEEEGHRIIKLNIGNLAPFGFDAPDEIIQDMIR
NLPASSGYSDSKGVFSARKAVMHYTQQKGVVGVGLDDIYIGNGASELIVMATQALLNDGD
EVLLPAPDYPLWTAAVSLSGGTPVHYVCDEQNAWMPDPDDIRRKITPNTKALVVINPNNP
TGALYSDELLLELLEIARQHGLIVFADEVYDKIVYDGLEHTALGSLSEDVITVTFNSLSK
SYRSCGYRAGWMSVSGLGGDNRRRANDYLEGLGILSSMRLCANVPGQFAIQTALGGYQSI
NELIVPSGRLYKQRELAYDMLTSIPGVTCVKPQAALYMFPRLDPKLYPIQNDQQFILDLL
LEERVLLVQGTGFNWAQPDHFRVVFLPNLDDLADSISRIARFLDGYRKRHSV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgattcagaagtcgaacaagctgctcaacgtctgctacgacatccgtggcccg
gtgctcgagcacgcgaagcgcctcgaggaagaaggccaccgtatcatcaagctgaacatc
ggcaacctcgcgccgttcggtttcgacgcgccggacgagatcatccaggacatgatccgc
aaccttcccgcgtcgtcgggctattcggattcgaagggcgtgttctcggcgcgcaaggcc
gtgatgcactacacgcagcaaaagggcgtggtcggcgtgggcctcgacgacatctacatc
ggcaacggcgcatccgagctgatcgtgatggcgacccaggcgttgctgaacgacggcgac
gaggtgctgctgccggcgcccgactacccgctgtggacggccgccgtgagcctgtcgggc
ggcacgcccgtgcactacgtgtgcgacgagcagaacgcgtggatgcccgaccccgacgac
atccgtcgcaagatcacgccgaacaccaaggcgctcgtcgtcatcaacccgaacaacccg
accggcgcgctgtattccgacgaattgctgctcgagctgctcgagatcgcgcgtcagcac
gggctgatcgtgttcgccgacgaggtctacgacaagatcgtctacgacggcctcgaacac
acggcgctcggctcgctgtcggaggacgtgatcaccgtcacgttcaacagcctgtcgaaa
agctatcgctcgtgcggctaccgcgcgggctggatgtccgtgtcgggcctcggcggcgac
aaccgccggcgcgcgaacgactatctggaggggctcggcatcctgtcgtcgatgcggctg
tgcgcgaacgtgccggggcagttcgcgatccagaccgcgctcggcggctaccagagcatc
aacgagctgatcgtgccgagcgggcgcctgtacaagcagcgcgaactcgcgtacgacatg
ctcacgtcgattccgggcgtgacctgcgtgaagccgcaggccgcgctgtacatgttcccg
cggctcgatccgaagctgtatccgatccagaacgatcagcagttcatcctcgacctgttg
ctcgaggagcgcgtgctgctcgtgcaggggacgggcttcaactgggcgcagccggatcac
ttccgcgtggttttcctgccgaacctcgacgatctggccgattcgatcagccggatcgcg
cgcttcctcgacggctaccgcaagcgccattcggtctga

DBGET integrated database retrieval system