KEGG   Burkholderia sp. KJ006: MYA_1720Help
Entry
MYA_1720          CDS       T02110                                 

Definition
Arylesterase precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
buk  Burkholderia sp. KJ006
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MYA_1720
Enzymes [BR:buk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYA_1720
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MYA_1720
Lipid biosynthesis proteins [BR:buk01004]
 Fatty acid synthase
  Component type
   MYA_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1851154..1851831
Genome map
AA seq 225 aa AA seqDB search
MDTTFRWKRRTALAALLATLCAATVPARAASAAPAAPEGRPTLVVLGDSLSAEYGLPRDT
GWVALLRQRLATERIDYSVANASVSGDTTSGGRARLPAVLQRLKPSIVIVELGSNDALRG
VPVATTEQNLRDIIAAARRAHAQVVLVGMYVPPNYGPDYTQKFHAVYTRLSKQLGVPLVP
FLLAGIENKPEMFQSDQMHPGEQAQRVLLDNVWPTLKPLLGKPRG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacattccgctggaaaaggcgcacggcgctcgccgcgctgctggctacattg
tgcgcagcgaccgtgcccgcgcgcgcggcgagcgccgcgccggccgcacctgagggccgg
cccacgctcgtcgtgctcggcgacagcctgtcggccgagtacgggctgccgcgcgacacc
ggctgggtggcgttgctgcggcaacggctcgcgaccgagcgaatcgattatagcgttgcg
aacgcaagcgtcagcggcgacaccacgagcggcggacgcgcgcgattgcccgccgtgctg
caacggctcaagccgtcgatcgtcatcgtcgagctcggttcgaacgatgcgctgcgcggc
gtgccggtcgcgacgaccgaacagaatctgcgcgacatcatcgccgctgcgcgacgcgcg
catgcgcaggtcgtactggtcggcatgtacgtgccgccgaattacgggcccgactacacg
cagaaattccacgcggtctatacgcgcctgtcgaagcaactcggcgtgccgctcgtgccg
ttcctgctggccggcatcgagaacaagccggagatgttccagtcggaccagatgcatccc
ggcgagcaagcgcagcgggttctgctcgacaacgtctggccgacgctgaagccgctgctc
ggcaagccgcgcggttga

DBGET integrated database retrieval system