KEGG   Burkholderia sp. KJ006: MYA_1820Help
Entry
MYA_1820          CDS       T02110                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00480  Glutathione metabolism
buk00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MYA_1820
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MYA_1820
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MYA_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174 Lipoprotein_15
Motif
Other DBs
NCBI-ProteinID: AFJ86181
UniProt: I2DNF5
Position
1:complement(1959703..1960182)
Genome map
AA seq 159 aa AA seqDB search
MSTLYSFSAETLAGEPVSLDAYRGKVLLIVNTASECGFTPQYAGLQKLYDRYAARGFFVL
GFPCNQFGKQEPGDATQIGAFCERNYGVTFPMFAKIDVKGDHAHPLYRYLTDEAPGILGL
KAIKWNFTKFLIGRDGRIVKRYAPSTKPEEIAADIDKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccctgtattcgttcagcgcagagacgctcgccggtgagccggtgtcgctcgac
gcgtatcgcggcaaggtcctgctgatcgtcaacaccgcgagcgagtgcggtttcacgccg
cagtacgcgggcctgcagaagctgtacgaccggtacgcggcgcgcggcttcttcgtgctc
ggttttccgtgcaaccagttcggcaagcaggagccgggcgatgcgacgcagatcggcgcg
ttctgcgagcgcaactacggcgtcacgttcccgatgttcgcgaagatcgacgtgaagggc
gaccacgcgcatccgctgtaccgctacctgaccgacgaggcgcccggcatcctgggcctg
aaggcgatcaaatggaacttcacgaagtttctgatcggtcgcgacgggcgcatcgtcaag
cgctacgcgccgtcgacgaagccggaggagatcgccgcggatatcgacaagctgctgtga

DBGET integrated database retrieval system