KEGG   Burkholderia sp. KJ006: MYA_1833Help
Entry
MYA_1833          CDS       T02110                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYA_1833
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MYA_1833
Enzymes [BR:buk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MYA_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1973705..1975012
Genome map
AA seq 435 aa AA seqDB search
MSRQQQALELQKQWDTDPRWTGIKRGYTADDVVRLRGSIAVEHTLAKRGAEKLWRLINEE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKDPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPFLTGERTVEGFFRTKPGLEQAISRGLAYAPYADLVWCETGKPDLEYAKKFAE
AIHKQFPGKMLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFEAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacagcaacaggcactggaactgcagaagcagtgggacaccgatccgcgctgg
acgggcatcaagcgcggctacacggccgacgacgtggtccgcctgcgcggctcgatcgcc
gtcgagcacacgctcgcgaagcgcggcgcggaaaagctctggcggctcatcaacgaggaa
ccgttcgtcaatgcgctgggcgcgctcacaggcaaccaggcgatgcagcaggtgaaggcc
gggctaaaggccatctatctgtcgggctggcaggtggccggcgacgcgaacgtcgccggt
gaaatgtacccggaccagtcactgtatccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctgacacgcgccgaccagatccagtggtcggaaggcaaggaccccggc
gacgaaggctacgtcgatttcttcgcgccgatcgtcgcggacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgagctgatgaaggcgatgatcgaggccggcgcgtcgggtgtc
cacttcgaggaccagctcgcgtcggtgaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaggccgtcgcgaagctgtcggcggcgcggctcgccgccgacgtgatg
ggcacgccgaccgttctggtcgcccgtaccgacgcggaagccgcggacctcatcacgtcc
gacatcgacgacaacgacaagccgttcctcaccggcgagcgcacggtcgaaggcttcttc
cgcaccaagccgggcctcgagcaggcgatctcgcgcggcctcgcgtatgcgccgtatgcg
gacctcgtgtggtgcgagacgggcaagccggatctcgagtacgcgaagaagttcgcggag
gcgatccacaagcagttcccgggcaagatgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcacgcagatgagcgcgttcgtcgaactgcagcaggcc
gagttcgaagcggccgacaagggtttcaccgcggtcaagcaccagcgcgaggtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgaccaccgcgctgcac
ggctcgaccgaggacgaacagttcttcgacggcaagaaggtggcataa

DBGET integrated database retrieval system