KEGG   Burkholderia sp. KJ006: MYA_1837Help
Entry
MYA_1837          CDS       T02110                                 

Definition
(RefSeq) Malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYA_1837
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYA_1837
   00630 Glyoxylate and dicarboxylate metabolism
    MYA_1837
Enzymes [BR:buk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYA_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1977692..1979284
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMAITGEIKPGYEAILTPEALAVVAALHRAFEPRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALYLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGIPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQIEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REYTKAELENVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatggcgatcaccggcgaaatcaagccgggc
tacgaagcgatcctgacgcccgaggcgctcgccgtcgtcgcggcgctgcatcgcgcattc
gagccacgtcgccaggcgctgctgcaggcgcgcgtcgagcgcacgaagcgcctcgacgcc
ggcgagcgccccgatttcctcgccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgtgtcgaaatcaccggccccgtcgagcgc
aagatgatcatcaacgcgctcaattcgggcgcggactcgtacatgaccgacttcgaggat
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcctacaagctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgaaaagcacgtgacggtcgacggc
cagcgcgtgtctggcgggattttcgatttcgcgctgtacctgttccacaacgcgaaggaa
ctgatcgcgcgcggctcgggcccgtacttctatctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcggtcggcatcccgcgcggc
acgatccgcgcgacggtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgtgacttctgcctggccgatcgctcgaagatc
acgatgacggtgccgttcatgcgcgcctacgcgctgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctggtgccgatcgcgatggaggaattcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgaa
ggccgcaacctgctcgatttccagccggaagcgccgatcaccgaagccggcctgcgcaac
aacatcaacgtcggcatccactacctcggcgcgtggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagacgcggccaccgcggaaatctcgcgctcgcaggtatggcag
tggatccgctcgccgaagggcgtactcgacgacggccgcaaggtgaccgccgagctcgtg
cgcgaatacacgaaggccgagctggagaacgtgaagcgctcggtcggcggcaacacgcag
ccgtacgagcgggccgcggcgatcttcgaacagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system