KEGG   Burkholderia sp. KJ006: MYA_1921Help
Entry
MYA_1921          CDS       T02110                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:buk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:buk00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:buk00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:buk00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2066437..2068089)
Genome map
AA seq 550 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKVGDTVEPEQSLVTLESDKATMDVPSPAAGTVKEV
KVKVGDAVSEGTLIILLEGGAAAQANGAAAAAAAPAPAAAPAAAAPAAAPAAAPAASGGT
LEVKVPDIGDYKDVPVIEIGVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKV
GDAVSEGTLIVLLEAAGAAAPAVAPASAPAPAAAAPAPAAAPAPAPAASAPAAAAPAAAP
SGEYRASHASPSVRKFARELGVDVARVPGSGPKGRITKDDITGFVKGVMSGQRAAPGAAA
APAGGGELNLLPWPKVDFAKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITE
LEALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAA
DTPNGLVVPVIRDADKKGLVDIAKEMAELSKAARDGKLKPDQMQGGCFSISSLGGIGGTH
FTPIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGA
LLADFRRIIL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtcaaggtgggcgacacggtcgagcccgagcagtcgctcgtcacgctc
gagtcggacaaggcgacgatggacgtgccgagcccggcagccggcacggtcaaggaagtg
aaggtcaaggtcggcgacgccgtgtcggaaggcacgctgatcatccttctcgaaggcggc
gcggccgcgcaggcgaacggcgccgcggcagcggccgccgcgccggcgccggctgctgcg
cccgctgccgctgcaccggctgctgcgccggctgctgcgccggctgcgtcgggcggtacg
ctcgaagtgaaggtgcccgacatcggcgactacaaggacgtcccggtgatcgagatcggc
gtgaagatcggcgacaccgtcgagaaagagcagtcgctcgtcacgctcgagtcggacaag
gcgacgatggacgtgccgagcccggccgctggcgtcgtgaaggacatcaaggtcaaggtc
ggcgatgcggtgtcggaaggcacgctgatcgtgctgctcgaagcggcaggtgcggctgca
ccggccgttgcgccggcgagcgcgccggctccggccgccgctgcaccggcaccggcggca
gcgcctgcgcccgcaccggcagcatcggcaccggccgctgctgcgccggctgccgccccg
tcgggcgaataccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctc
ggcgtcgacgtcgcgcgcgtgccgggcagcggcccgaaggggcgcatcaccaaggacgac
atcacgggcttcgtgaagggcgtgatgtcgggccagcgcgcggcgccgggcgcggcagcc
gcgccggcaggcggcggcgagttgaacctgctgccgtggccgaaggtcgacttcgcgaag
ttcggcccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctg
catcgcaactgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgag
ctcgaagcgctgcgcgtgcagctgaacaaggagcacgagaaggcgggcgtgaagttcacg
atgctcgcgttcgtgatcaaggcagtggtggccgcgctgaagaaattcccgaccttcaac
gcgagcctcgacggcgacaacctggtgttcaagcagtactaccacatcgggttcgcggcc
gacacgcccaacggtctcgtcgtgccggtgatccgcgatgcggacaagaagggcctcgtc
gacatcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgacggcaagctcaagccc
gaccagatgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcac
ttcacgccgatcatcaacgcgccggaagtggcgatcctcgggttgtcgcgcgggcagatg
aagccggtgtgggacggcaagcagttcgtgccgcggttgacgttgccgctttccctgtcg
tacgaccatcgcgtgatcgatggcgccgaagccgcgcggttcaatgcgtatctcggcgcg
ttgctcgcggatttccgtcgcatcattctttga

DBGET integrated database retrieval system