KEGG   Burkholderia sp. KJ006: MYA_2043Help
Entry
MYA_2043          CDS       T02110                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYA_2043
   01230 Biosynthesis of amino acids
    MYA_2043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_2043
   00051 Fructose and mannose metabolism
    MYA_2043
   00562 Inositol phosphate metabolism
    MYA_2043
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MYA_2043
Enzymes [BR:buk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYA_2043
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYA_2043
  Exosomal proteins of bladder cancer cells
   MYA_2043
  Exosomal proteins of melanoma cells
   MYA_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2223292..2224047)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGADAVAAGTSIGVCVPFPYLAQVQAVLGG
SRVAFGAQDVSAHEQGAYTGEVAAAMVAEFGAQYAIVGHSERRAYHGERNETVAAKAQRA
LAAGLTPVVCVGETLDEREAGTTERVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcggacgcagtggcggccggcacg
tcgatcggcgtatgcgtgccgttcccctatctcgcgcaggttcaggcggtgctcggcggc
agccgggtggcgttcggcgcacaggacgtgtcggcgcacgagcagggcgcgtacaccggc
gaagtggcggccgcgatggtcgcggaattcggcgcgcagtatgcgatcgtcggtcactcg
gagcgtcgcgcgtatcacggcgagcgcaacgagaccgtcgccgcgaaggcgcagcgcgcg
ctcgcggcgggcctcacgccggtcgtgtgcgtcggcgaaacgctcgacgagcgcgaagcg
ggcacgaccgagcgggtcgtcggtgcgcagctcgacgccgtgcttgccgtgctgacggcc
gacgaggcggcgcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggacgttcacgcgttcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtgtcggtgctgtacggtggcagcgtcaagccggacaacgcggaa
gaactgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggct
gaagattttctggcgatctgccgggctgcgcgttga

DBGET integrated database retrieval system