KEGG   Burkholderia sp. KJ006: MYA_2043Help
Entry
MYA_2043          CDS       T02110                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00051  Fructose and mannose metabolism
buk00562  Inositol phosphate metabolism
buk00710  Carbon fixation in photosynthetic organisms
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
buk01230  Biosynthesis of amino acids
Module
buk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
buk_M00002  Glycolysis, core module involving three-carbon compounds
buk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_2043
   00051 Fructose and mannose metabolism
    MYA_2043
   00562 Inositol phosphate metabolism
    MYA_2043
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MYA_2043
Enzymes [BR:buk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYA_2043
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYA_2043
  Exosomal proteins of bladder cancer cells
   MYA_2043
  Exosomal proteins of melanoma cells
   MYA_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFJ86403
UniProt: I2DP27
Position
1:complement(2223292..2224047)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGADAVAAGTSIGVCVPFPYLAQVQAVLGG
SRVAFGAQDVSAHEQGAYTGEVAAAMVAEFGAQYAIVGHSERRAYHGERNETVAAKAQRA
LAAGLTPVVCVGETLDEREAGTTERVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgctgctgaacgaagtggtgcagggcgcggacgcagtggcggccggcacg
tcgatcggcgtatgcgtgccgttcccctatctcgcgcaggttcaggcggtgctcggcggc
agccgggtggcgttcggcgcacaggacgtgtcggcgcacgagcagggcgcgtacaccggc
gaagtggcggccgcgatggtcgcggaattcggcgcgcagtatgcgatcgtcggtcactcg
gagcgtcgcgcgtatcacggcgagcgcaacgagaccgtcgccgcgaaggcgcagcgcgcg
ctcgcggcgggcctcacgccggtcgtgtgcgtcggcgaaacgctcgacgagcgcgaagcg
ggcacgaccgagcgggtcgtcggtgcgcagctcgacgccgtgcttgccgtgctgacggcc
gacgaggcggcgcgcatcgtcgtcgcgtacgagccggtctgggcgatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggacgttcacgcgttcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtgtcggtgctgtacggtggcagcgtcaagccggacaacgcggaa
gaactgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggct
gaagattttctggcgatctgccgggctgcgcgttga

DBGET integrated database retrieval system