KEGG   Burkholderia sp. KJ006: MYA_2441Help
Entry
MYA_2441          CDS       T02110                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYA_2441
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MYA_2441
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYA_2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2641594..2643096
Genome map
AA seq 500 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVA
AEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSLKQQGL
EAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFGTVDSWLVWNFTKHELHV
TDVTNASRTMLFNIHTREWDSELLELLDIPRSMLPEVKASSEIYGHTKTTVFASKIPLAG
IAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIESRNNLVTTIAWQIGDDVQYA
LEGSIFIAGAVVQWLRDGMGIIKTAAEIEALAARVPHTDGVYLVPAFAGLGAPHWNARAR
GSVFGVTRGTTSAHLARAALDAIAYQSLDVLAAMEADSGISIGELRVDGGASANNLLMQF
QADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDEVRSQWQLDRRFSPSMPKEQVKQ
CMAGWQRAVRAAKAWADDTQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccagtacatcctcgcgcttgaccagggcacgacgagctcccgcgcaatgctg
ttcgatcgccagggcaacatcgtttcgatcgcccagaaggaattcgaacagatctacccg
caacccggctgggtcgagcacgacccgcaggaaatctggtcgacgcaagccggcgtcgcc
gccgaagccgtcacgcgcacgggcctgaacggcacgtcgatcgcggcgatcggcatcacc
aaccagcgcgagacgaccatcgtctgggatcgcgaaaccggccagccggtctacaacgcg
atcgtgtggcaggaccgccgcaccgccgacttctgcgattcgctcaagcagcagggcctc
gaggcgaaggtgcgcgcgaagaccggcctgccgatcgactcgtacttctccgcgaccaag
atccgctggattctcgacaacgtgccgggcgcgcgcgacaaggcgcgccagggcaagctc
gcgttcggcacggtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtc
accgacgtgacgaacgcatcgcgcacgatgctgttcaacattcacacgcgcgagtgggac
agcgagctgctcgagctgctcgacatcccgcgcagcatgctgccggaagtgaaggcttcg
tcggaaatctacggccatacgaagacgacggtgttcgcgtcgaagattccgctcgcgggc
atcgcgggcgaccagcacgcggcgctgttcggccagatgtgcacgacctcgggcatggtc
aagaacacctacggcaccggctgcttcctgatgatgaacaccggcgacaagccgatcgag
tcgaggaacaacctcgtcacgacgatcgcctggcagatcggcgacgacgtgcagtacgcg
ctcgaaggcagcatcttcatcgcgggcgcggtcgtgcaatggctgcgcgacgggatgggc
atcatcaagacggccgccgaaatcgaagcgctggccgcgcgcgtgccgcataccgacggc
gtctatctggtgccggcgttcgcgggcctcggcgcgccgcactggaatgcccgcgcgcgc
ggctcggtgttcggcgtcacgcgcggcacgacgtccgcccatctcgcgcgcgcggcgctc
gacgcgatcgcgtatcagtcgctcgacgtgctggccgcgatggaagccgactcggggatc
agcatcggcgagctgcgcgtcgacggcggcgcgagcgcgaacaacctgctgatgcagttc
caggccgatctgctcggcgtcgacgcggtgcgtccgcagatcaccgagacgaccgcgctc
ggcgcggcctacctcgcgggcctcgcgatcggctactggaagaacctcgacgaagtgcgc
agccagtggcagctcgatcgccgcttctcgccgtcgatgccgaaggagcaggtcaagcag
tgcatggccggctggcagcgcgcggtgcgcgcggccaaggcgtgggccgacgacacgcag
taa

DBGET integrated database retrieval system