KEGG   Burkholderia sp. KJ006: MYA_2582Help
Entry
MYA_2582          CDS       T02110                                 

Definition
Beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
buk  Burkholderia sp. KJ006
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_2582
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MYA_2582
Enzymes [BR:buk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYA_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2788106..2790613
Genome map
AA seq 835 aa AA seqDB search
MKRPLPFLFAGVLIAALLPSASRAEPVPAGAGSVTASVVVPAAGIARPAMRPADLAALLS
NGLALRVAVDNNHAAATGVPCADLGADGAACATGRLFLQNRGHRPIADGGWKLYLHSIRR
LLRIDRPGFALRRLTGDLYELTPQPGSLRLAPGERIALPFVAEYWLRRYSDVIPRPYVVV
DGAPPTVLRYNDTDDELRYVESLPADAQNSSTGNAPPVAARPDASRALPSVKREQRLPGA
LELRGVELVLPELPDAQVAALRERAATLGLDGARARVRGVVAPRRLPADIATPGGYRLAI
GPRGVLVEGYDRAGLYYGVQTLFSLAPAGGGPVPALLVEDAPRFTHRGMHVDLARNFKHP
ATLRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDIGARRCHDPSETRCLLPQLG
SGPDNRSGGGYLTRADYVALVRYAVDRFVEVIPEIDMPAHARAAVVSMEARYRRLHAAGR
DQEANAYRLLDPQDTSNLTTVQFYDRRSDLNPCVPGALNFASKVIREIAAMHADAQAPLR
IWHFGGDEAKNILLGGGFQPLNGTDPNKGRIDLAAQDKPWARSPACAALLQRGEIRSIDE
LPTRFAKQVSAAVDANGIDTMAAWQDGIKHASGPRDFSTRHVMVSLWDTIFWGAADSARD
LSNAGYLTVLALPDYLYFDFPYTLNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVMGD
RDGNAFEATGTGPAPRIEGIQGQAWGEVMRNDTFLEYMVYPRLLALAERAWHRADWELPY
AAGVRYKRGDTHHVDTAALQRDWAGFATLVVQRELPKLDRAGIGYRKPSFTVTNP
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcccgttgcccttcctgtttgccggcgtgctgatcgcggcgctgctgccgtcc
gcaagccgcgccgaacccgtgccggccggcgccggctcggtgaccgcctcggtggtcgtg
ccggccgccggcatcgcgcggcccgccatgcggccggccgacctcgctgcgttgctgtcg
aacggcctcgcgctgcgcgtcgccgtcgacaacaaccatgcggcggcgaccggcgtgccg
tgcgccgatctcggcgccgacggcgccgcctgcgcgaccggccgcctgttcctgcagaac
cgcggccaccgcccgatcgccgacggcggctggaagctctatctgcacagcatccgacgg
ctgctgcgtatcgatcgtccgggcttcgcgttgcggcggctcacgggcgacctgtacgag
ctgacgccgcagccgggctcgctgcggctcgcgcccggcgagcgcatcgcgttgccgttc
gtcgccgaatactggctgcgacgctacagcgacgtgataccgcgcccgtatgtggtggtc
gacggcgcgccgccgacggtgctgcgctacaacgataccgacgacgaactgcgctacgtc
gaatcgctgccggccgatgcgcagaacagctcgaccggcaatgcgccgccggtggccgcg
cggccggacgcgagccgcgcgctgccgagcgtgaagcgcgagcagcggctgcccggcgcg
ctcgagctgcgcggcgtcgagctggtgctgcccgagttgcccgatgcgcaggtcgcggcg
ctgcgcgaacgcgcggcgacgctcgggctggacggcgcccgcgcgcgcgtgcgcggcgtg
gtcgcgccgcgccggctgccggccgacatcgcgacgccgggcggctaccggctcgcgatc
gggccgcgcggcgtgctcgtcgaaggctacgatcgcgccggcctctactacggcgtgcag
acgctgttctcgctcgcgccggccggcggcggcccggttccggcgctgctcgtcgaggac
gcgccgcgcttcacgcatcgcggcatgcacgtcgatctcgcgcgcaacttcaagcatccg
gcgacgctgcgccgcctgatcgaccagatgagcgcgtacaagctcaaccggctgcacctg
cacctgtccgacgacgaaggctggcgcatcgagatccccgggctgcccgagctgaccgac
atcggcgcgcgccgctgtcacgatccgtccgagacgcgttgcctgctgccgcagctcggc
tccggcccggacaaccgctcgggcggcggctatctgacgcgcgccgactacgtcgcgctg
gtgcgctacgcggtcgaccgcttcgtcgaggtgattcccgaaatcgacatgccggcccat
gcgcgcgcggccgtcgtgtcgatggaagcgcgctaccggcgcctgcatgcggccggccgc
gaccaggaggcgaacgcgtatcggctgctcgacccgcaggacacgtcgaacctgaccacg
gtgcagttctacgatcggcgcagcgatctgaacccgtgcgtgccgggcgcgctgaacttc
gcgtcgaaggtgatccgcgagatcgcggcgatgcacgcggacgcgcaggcgccgctgcga
atctggcatttcggcggcgacgaagcgaagaacatcctgctcggcggcggcttccagccg
ctgaacggcaccgatccgaacaaggggcgcatcgacctcgccgcgcaggacaagccgtgg
gcgcgctcgcccgcgtgcgcggcgctgctgcagcgtggcgagatccgctcgatcgacgag
ctgccgacgcgcttcgcgaaacaggtcagcgcggcggtagacgcgaacgggatcgacacg
atggccgcgtggcaggacggcatcaagcacgcgagcgggccgcgcgatttcagtacgcgt
cacgtgatggtgtcgctgtgggacacgatcttctggggcgcggcggacagcgcgcgcgac
ctcagcaacgccggctatctgaccgtgctcgcgctgcccgactacctgtacttcgacttc
ccgtacacgctgaatccgcgcgagcgcggctattactggggatcgcaggcaaccgacgag
tacaaggtgttctcgctcgcgcccgagaacctgccgcagaacgccgaggtgatgggcgat
cgcgacggcaacgcgttcgaggcgaccggcacgggccccgcgccgcgcatcgagggcatc
caggggcaggcatggggcgaggtgatgcgcaacgacacgttcctcgagtacatggtgtat
ccgcggctgctcgcactcgccgaacgcgcgtggcatcgcgccgactgggagctgccctat
gcggccggcgtgcgctacaagcgcggcgacacgcatcacgtcgacaccgcggcactccag
cgagactgggccggcttcgcgacgctggtcgtccagcgcgagctgccgaagctcgaccgc
gcggggatcggttatcgcaagccgagcttcacggtgacgaacccgtaa

DBGET integrated database retrieval system