KEGG   Burkholderia sp. KJ006: MYA_2616Help
Entry
MYA_2616          CDS       T02110                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00260  Glycine, serine and threonine metabolism
buk00680  Methane metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
buk01230  Biosynthesis of amino acids
Module
buk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
buk_M00002  Glycolysis, core module involving three-carbon compounds
buk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_2616
  Energy metabolism
   00680 Methane metabolism
    MYA_2616
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYA_2616
Enzymes [BR:buk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MYA_2616
Membrane trafficking [BR:buk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MYA_2616
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MYA_2616
  Exosomal proteins of melanoma cells
   MYA_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFJ86976
UniProt: I2DQQ0
Position
1:2823740..2824486
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGALLKEAGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTP
PPALEPTDERAPFSDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRAGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDENLKPIQHYYLGDQDAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggccgcaacgaagcctaccaggccggc
gcattgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggacaagatggacctgatgtatctgccggtcgtt
cactcgtggcgcctgaacgagcgccactacggcgcactgtcggggctgaacaaggccgaa
acggccgcgaagttcggcgacgaccaggtcctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgaccgacgaacgcgcgccgttcagcgatccgcgctacgcgaag
gtgccgcgcgagcagctgccgctcaccgaatgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgagtcgatcgcgccggccgtgcgcgccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatctcggacagcgac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctatgaactcgacgagaacctc
aagccgatccagcattactacctgggcgaccaggacgcgatcgcgaaggcgcaggccgcc
gtcgcaaagcaaggcaaggcgggctga

DBGET integrated database retrieval system