KEGG   Burkholderia sp. KJ006: MYA_3162Help
Entry
MYA_3162          CDS       T02110                                 

Definition
Agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
buk  Burkholderia sp. KJ006
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYA_3162
Enzymes [BR:buk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     MYA_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:256899..257972
Genome map
AA seq 357 aa AA seqDB search
MKVDVYVDMFAFFFRARRAKLCARPRRMIRQPHIDREQPMNDPLHFQPLGGNEMPRSGGI
ATMMRLPHVASAAGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPF
DSLQVADIGDVAINPYNLHDSIARIEAAYDAILAQDCKPITLGGDHTIALPILRAIHRKH
GKVALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDW
CRDQGFRVVQAEACWNQSLVPLMEEVRARVGDTPVYISFDIDGIDPAYAPGTGTPEIAGL
TVPQALEIIRGAKGLNIVGCDLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgatgtttacgtcgacatgttcgcattcttctttcgcgcgcggcgcgcaaaa
ctatgcgccaggccgcgtcgaatgatacggcaaccccatatcgacagagaacagcccatg
aacgaccctctccatttccagccgctcggcggcaacgaaatgccgcgcagcggcggcatt
gcgaccatgatgcgcctgccgcacgtcgcgagcgccgcggggctcgacgcgtgtttcgtc
ggcgtgccgttcgatctcggcacgtcgaaccgtaccggcgcgcgcttcggcccgcgccag
atccgcacggagtcggtgctgctgcgcccgtacaacatggccacgcgggcggcgccgttc
gattcgctgcaggtcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcacgat
tcgatcgcccgcatcgaggccgcgtacgacgcgatcctcgcgcaagactgcaagccgatc
acgctcggcggcgaccacacgatcgcgctgccgatcctgcgcgcgatccatcgcaagcac
ggcaaggttgcattgatccacgtcgatgcacacgccgacgtgaacgacacgatgatgggc
gagaagatcgcgcacggcacgccgtttcgccgcgcggtcgaagaaggcctgctgcacggc
gacaaggtcacgcagatcggcctgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgaccagggttttcgcgtcgtgcaggccgaggcgtgctggaaccagtcgctcgtg
ccgctgatggaggaagtgcgcgcgcgcgtcggcgacacgcccgtctacatcagcttcgac
atcgacggcatcgaccccgcctacgcgcccggcaccggcacgccggaaatcgcgggcctc
acggtgccgcaggcgctcgagatcattcgcggcgcgaaggggctgaacatcgtcggctgc
gatctcgtcgaagtcgcaccgccgtacgacccgttcggcaccaccgcgctgctcggcgcg
aacctcgcgtacgagctgctgtgcgtgttgccgggcgtcgcgtatcgcgattga

  All links  
No link information was found.   
DBGET integrated database retrieval system