KEGG   Burkholderia sp. KJ006: MYA_3404Help
Entry
MYA_3404          CDS       T02110                                 

Definition
GTP cyclohydrolase I type 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
buk  Burkholderia sp. KJ006
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYA_3404
Enzymes [BR:buk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYA_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:524638..525267
Genome map
AA seq 209 aa AA seqDB search
MGKKTTRPEPAASRPTREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYAL
EPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLAR
LVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRM
LGTFRTDPSTRREFLSIVANPSSVNLTNT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaaaccacgcggcccgaaccggccgcctcccggccgacccgggaagaagcc
gaggatgccgttcgcgtgctgctgcgctgggccggcgacgatccggcccgcgaaggcctg
ctcgacaccccggcgcgggtcgtgcgcgcatacgagcagttcttcgccggctatgcgctg
gagccgcgcgacatcctcgcgcgcaccttcagcgaagtcgacggctacgacgaaatgatc
gtgctgaaggacatccgcttcgagagctactgcgagcatcacatggtgccgatcatcggc
cgtgcgcacgtggcctatctgccgaaccatcgcgtcgtcggcatctcgaagctcgcgcgc
ctcgtcgatgccttcgccaagcgcctgcagatccaggaaaagatgaccgtgcagatcgcc
gatacgctgttcgacgtgctgcagccgaagggcgtcggcgtgatcctcgaagccgcgcac
cagtgcatctcgacgcgcggcgtgcacaagcccggcgtggaaatggtcacgtcgcgcatg
ctcggcacgttccgcaccgatccgtcgacgcggcgcgaattcctgtcgatcgtcgcgaac
ccttcttcagtcaacctcaccaacacgtaa

DBGET integrated database retrieval system