KEGG   Burkholderia sp. KJ006: MYA_3435Help
Entry
MYA_3435          CDS       T02110                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
buk  Burkholderia sp. KJ006
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:buk00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:buk00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:554762..555547
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIGV
AMDVTNEDAVNSGIDKVAETFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggcaag
gaaatcgcgctggagctggcgaaggccggcgcggccgtcgcgatcgccgacctgaaccag
gacggcgcgaacgcggtggccgatgagatcaacaaggccggcggcaaggcgatcggcgtc
gcgatggacgtcaccaacgaggacgcggtgaacagcggcatcgacaaggtcgccgagacg
ttcggctcggtcgacatcctggtgtcgaacgcgggcatccagatcgtcaacccgatcgag
aactactcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttcctc
acgaccaaggctgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtcatctac
atgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
catgggctgctggggctcgcgcgcgtgctggccaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccggag
caggcgaaggagctcggcatcagcgaagaagaagtggtgaagaaggtgatgctcggcaac
acggtggacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctgtcg
gcgttcccgagcgccgcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caataa

DBGET integrated database retrieval system