KEGG   Burkholderia sp. KJ006: MYA_3473Help
Entry
MYA_3473          CDS       T02110                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00620  Pyruvate metabolism
buk00630  Glyoxylate and dicarboxylate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01200  Carbon metabolism
Module
buk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYA_3473
   00630 Glyoxylate and dicarboxylate metabolism
    MYA_3473
Enzymes [BR:buk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYA_3473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFJ87832
UniProt: I2DT56
Position
2:complement(599977..602151)
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIEDEALPGTGIDKAAFWSGFSALVHEFAPRNRELLAERERLQHE
LDAWHRAHPGPVRDHAAYRAFLERIGYLVPVPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTTAYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVEDGQLAVETASGVVHLAQPAQFVGYQGAAGAPSAILLKHNGLHVEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLTLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDRKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAGRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
AAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQALEKTPYASERDALLEGLLTVPVVERAEWSDSEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPDYEQSTAFAAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QQSA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctgagccagttcattgaagacgaa
gcactgccgggcaccggcatcgacaaggccgcattctggagcggtttttcggcgctggtg
cacgagttcgcgccgcgcaaccgcgaattgctcgcggagcgcgagcgcctgcagcacgaa
ctggacgcgtggcaccgcgcgcaccccggcccggtacgcgaccatgccgcgtaccgcgca
ttcctcgaacgaatcggctacctcgtgccggtcccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctacgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgatgcgctgcccgaagacggcggcgccgagcgcaccacggcctacaacccgacg
cgcggacagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctcgcg
agcggttcgcatcgcgacgcgctgcgctaccgcgtggaggacggccagctcgccgtcgaa
accgccagcggcgtcgtgcaccttgcgcagcctgcgcagttcgtcggctaccagggcgca
gccggcgcgccgtccgcgatcctgctgaagcacaacggcctgcacgtcgagatccagatc
gatgcgtccacaccgatcggccgcgcggacctcgcaaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgacgccgacgac
aaggtccagctgtaccgcaactggctcgggctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgaccgcgaatacacgacgccg
gccggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccat
ctgatgaccaacggcgcggtgctcgatcgcgacggcaacgagattccggaagggatcctc
gacggcgtcgtcacgacgctgtgcgcgctgcacgaccggaaggccaagcgcaactcgcgc
accggctcgatctacatcgtgaagccgaagatgcacggcccggtcgaggtcgcgttcgcc
gacacgctgttcgcgcgcatcgaggatctgtacgggctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcctgcatcgcggcggcg
gccgggcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgaaatgcac
accgcgatggaagccggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
gccgcctacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgtgcg
cagatcggcaagggcatgtgggcgatgcccgacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcgtgggtgccgtcgccgaccgcggcgacg
ctgcacgcgctgcattaccacctcgtcgacgtgcaggccgtccagcaggcgctcgaaaag
acgccgtacgcgagcgagcgcgacgcgctgctcgaagggctgctgacggtcccggtggtc
gaacgcgccgagtggagcgacagcgagatcctgagcgaagtcgagaacaatgcgcagggc
atcctcggctacgtcgtgcgctgggtcgaacaaggggtcgggtgctcgaaggtgccggac
atccacgacgtcggcctgatggaagaccgcgcgacactgcgcatctcgagccagcacatc
gcgaactggctgcgccacggcgtgatcaccgaggcgttcgtgctggacgtgttcaagcgg
atggcgcgcgtcgtcgatcagcagaacgcgggcgatccgaactaccggccgatggcgccc
gactacgagcagtccaccgcgttcgccgcggcatgcgcgctcgcgctgcagggcacgtcg
cagccgagcggctataccgagccgctgctgcatcggttccggctcgcgttcaaggcgcaa
cagcaaagcgcgtaa

DBGET integrated database retrieval system