KEGG   Burkholderia sp. KJ006: MYA_3690Help
Entry
MYA_3690          CDS       T02110                                 

Definition
Fatty acid desaturase, Delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:buk01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:buk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:834298..835257
Genome map
AA seq 319 aa AA seqDB search
MAEADLSSSRTPAAARAADADTDSRARRLAYLTVGVPALGFVLAIAYTWTYGVRATDFIL
LAVMYFSTAIGVETGMHRYFSHRAFKGRPIVTVMLGVFGSMAAQGPILFWAATHRMHHAF
TDQDGDPHSPLPRANRHGQPSRLAGLWHGHVGWLFSVRRENWSAYAADLLRDRLIVNLNL
RYGWWVLLGLALPALAGALLAPAGQALTGAVGGFLWGGLARIFLLDQSTWAVNSLCHTIG
TRPHATRDHSRNLGLLAIVSVGGAWHNNHHAQPAFANNDHAFWQLDPSAWVIRLLDALGL
VTEVRYAPKRRATVPSISP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcagatctctcgtcgtcgcgaacacccgcggccgcccgtgcggccgacgcc
gacaccgactcgcgcgcgcgccggctcgcttatctgaccgtcggcgtgcccgcgctcggt
ttcgtgctcgcgattgcctacacgtggacatacggcgtgcgcgccaccgacttcatcctg
ctcgcggtgatgtatttctcgaccgcgatcggcgtcgaaaccggcatgcaccgttacttc
tcacaccgtgcgttcaagggacggccgatcgtcaccgtgatgctcggcgtattcggcagc
atggccgcccaggggccgatcctgttctgggccgcgacgcaccgcatgcaccacgcgttc
accgatcaggacggcgatcctcattcgccgctgccgcgcgcgaaccgccacggccaaccg
agccggctcgcgggcctttggcacggtcacgtgggctggctgttcagcgtgcgccgcgag
aactggagcgcgtatgccgcggacctgctgcgcgaccgcctgatcgtcaatctcaatctg
cgctatgggtggtgggtgctgctcggcctcgcgctgcccgcgctggcgggcgcgttgctc
gcgcccgccgggcaggccttgaccggcgccgtcggcggtttcctgtggggcgggctcgca
cggatcttcctgctcgatcagtcgacctgggccgtcaattcgctgtgccacaccatcggc
acccgcccgcacgcgacgcgcgaccacagccgcaatctgggcctgctcgcgatcgtctcg
gtgggcggcgcgtggcacaacaaccatcacgcacagccggccttcgccaacaacgatcac
gcgttctggcagctcgatccttccgcctgggtcatccgcctgctcgacgcgctggggctc
gtcacggaggtgcgctatgcgcccaagcgccgcgcgacggttccttcaatttcgccgtaa

DBGET integrated database retrieval system