KEGG   Burkholderia sp. KJ006: MYA_3691Help
Entry
MYA_3691          CDS       T02110                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYA_3691
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MYA_3691
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MYA_3691
Lipid biosynthesis proteins [BR:buk01004]
 Desaturase
  First
   MYA_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:835283..836266
Genome map
AA seq 327 aa AA seqDB search
MNSSIQVAPGVTAAGGLSAADGQIPGVSPLLGSGARVKRLTALAVMLVPLAGFALAVRQL
ALGEFAATDLVLFAVFYFLHMGGITMGFHRYLAHKTFRTSKWFEGLLLICGSMAAQGPIM
FWVTTHRRHHLYSDQQGDPHSPNLAGKGLFAKLRGLWYAHMPWMLAPDVSGWTFFAPDVL
RDRRLFFYHRTYAWWIVLGLVLPAAIGGAVAGSWLGAWNGLLFGGLARIFVANQAAWCVG
SVCHMFGGRPFKTGDNSANNWTVAVFTFGEGLQNNHHAFPASYRHSVKWYEPDLSAWVLW
TLGKVGIVRDLRQPTPAAIRKLAKQPY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgtcgattcaggttgcacccggcgtgactgccgcaggcgggctgtcggccgcc
gacgggcagatccccggtgtttcgccgctgctgggcagcggggcgcgtgtcaaacgcttg
accgccctggccgtgatgctggtgccgctggccggcttcgcgctggccgtgcgccagctc
gcgctgggcgagttcgccgccaccgatctcgtgctgttcgcggtgttctattttctgcac
atgggcgggatcacgatgggcttccatcggtatctcgcgcacaagacgttccgcacgtcg
aagtggttcgaagggctgctgctgatctgcgggtcgatggccgcgcaaggaccgatcatg
ttctgggtgacgacgcaccgccgacatcacctgtacagcgatcagcaaggcgatccgcat
tcgccgaatctggccggcaagggcctgttcgcgaagctgcgcggcctctggtatgcgcac
atgccgtggatgctggcccccgacgtctcgggctggaccttcttcgcgcccgacgtgctg
cgcgatcgccgcctgttcttctatcaccgcacctacgcctggtggatcgtgctcggcctc
gtgctgccggccgcgatcggcggcgccgtcgccggctcgtggctcggcgcatggaacggc
ctgctgttcggcggattggcgcgcatcttcgtggccaaccaggccgcgtggtgcgtgggg
tccgtgtgccacatgttcggcggccggccgttcaagaccggggacaacagcgcgaacaac
tggacggtcgccgtattcacgttcggcgaaggcctgcagaacaaccaccacgcgtttccc
gcgtcgtaccgccactcggtgaagtggtacgagccggatctgagcgcctgggtgctgtgg
acgctcggcaaggtcggcatcgtgcgcgacctgcgtcagccgacgccggcggcgatccgc
aagctcgccaagcagccgtattga

  All links  
No link information was found.   
DBGET integrated database retrieval system