KEGG   Burkholderia sp. KJ006: MYA_3879Help
Entry
MYA_3879          CDS       T02110                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
buk  Burkholderia sp. KJ006
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:buk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MYA_3879
Enzymes [BR:buk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MYA_3879
Two-component system [BR:buk02022]
 CheA family
  WspE-WspRF [MD:M00509]
   MYA_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1040085..1041104
Genome map
AA seq 339 aa AA seqDB search
MNIGIVNDLPLAVEALRRVIASRTEHRVLWVATDGDEAVDFCIAQPPDLVLMDLVMPKLD
GVAATRQIMARAPCAILIVTADVSANTSSVYEAMGAGALDAVDTPTLALGLPSDAAPQPL
LAKIDQIGRLLESRAAPLAPCARMPACGQPTLVAIGASAGGPTALTALLRALPADFPAAL
VIVQHVDQAFAVGMAEWLDGHTRLPVRIARQGGVPRAGEVLLAATNDHLSLSPRGVLGYT
RHPVDTPYRPSIDVFFTSVADGWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEAT
SAVYGMPKAAAAIGAAAAILPLERIAPRLISRVMRRSPD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatctgccgctggccgtcgaggcgctgcgccgcgtgatc
gcctcgcgcaccgaacatcgcgtgctgtgggtcgcgactgacggcgacgaagcggtggac
ttctgcatcgcgcagccgcccgatctcgtgctgatggatctcgtgatgccgaagctcgac
ggcgtcgccgcgacgcggcagatcatggcgcgtgcgccgtgcgcgatcctgatcgtgacc
gcggacgtcagcgcgaacacgtcgtcggtctacgaggcgatgggcgcgggcgcgctcgat
gcggtcgacacgccgacgctcgcgctcggcctgccgtcggacgccgcgccgcagccgctg
ctcgcgaagatcgaccagatcggccgcctgctcgaaagccgcgcggcgccgctcgcgccg
tgcgcgcggatgccggcgtgcggccagccgacgctcgtcgcgatcggcgcgtccgccggc
gggccgaccgcgctcaccgcgctgctgcgcgcgttgccggccgatttcccggccgcgttg
gtgatcgtgcagcacgtcgatcaggcgttcgcggtcggcatggcggagtggctcgacggc
cacacgcggctgcccgtgcgcatcgcgcggcagggcggcgtgccgcgtgcgggcgaggtg
ctgctggccgccaccaacgatcacctgagcctgtcgccgcgcggcgtgctcggctatacg
cggcacccggtcgacacgccgtaccggccgtcgatcgacgtgttcttcaccagcgtcgcc
gacggctggcggggcgacgcgctcggcgtgctgctgacgggcatggggcgcgacggcgcg
ctggggttgaaggcgatgcgcgcgaagggctgctacacgatcgcgcaggacgaggcgacc
agtgcggtgtacgggatgccgaaggccgccgcggcgatcggcgcggcggctgcgatcctg
ccgctcgagcgcatcgcgccgcggctcatctcgcgcgtgatgcgccgctcgcccgactga

DBGET integrated database retrieval system