KEGG   Burkholderia sp. KJ006: MYA_3879Help
Entry
MYA_3879          CDS       T02110                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
buk  Burkholderia sp. KJ006
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:buk02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1040085..1041104
Genome map
AA seq 339 aa AA seqDB search
MNIGIVNDLPLAVEALRRVIASRTEHRVLWVATDGDEAVDFCIAQPPDLVLMDLVMPKLD
GVAATRQIMARAPCAILIVTADVSANTSSVYEAMGAGALDAVDTPTLALGLPSDAAPQPL
LAKIDQIGRLLESRAAPLAPCARMPACGQPTLVAIGASAGGPTALTALLRALPADFPAAL
VIVQHVDQAFAVGMAEWLDGHTRLPVRIARQGGVPRAGEVLLAATNDHLSLSPRGVLGYT
RHPVDTPYRPSIDVFFTSVADGWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEAT
SAVYGMPKAAAAIGAAAAILPLERIAPRLISRVMRRSPD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatctgccgctggccgtcgaggcgctgcgccgcgtgatc
gcctcgcgcaccgaacatcgcgtgctgtgggtcgcgactgacggcgacgaagcggtggac
ttctgcatcgcgcagccgcccgatctcgtgctgatggatctcgtgatgccgaagctcgac
ggcgtcgccgcgacgcggcagatcatggcgcgtgcgccgtgcgcgatcctgatcgtgacc
gcggacgtcagcgcgaacacgtcgtcggtctacgaggcgatgggcgcgggcgcgctcgat
gcggtcgacacgccgacgctcgcgctcggcctgccgtcggacgccgcgccgcagccgctg
ctcgcgaagatcgaccagatcggccgcctgctcgaaagccgcgcggcgccgctcgcgccg
tgcgcgcggatgccggcgtgcggccagccgacgctcgtcgcgatcggcgcgtccgccggc
gggccgaccgcgctcaccgcgctgctgcgcgcgttgccggccgatttcccggccgcgttg
gtgatcgtgcagcacgtcgatcaggcgttcgcggtcggcatggcggagtggctcgacggc
cacacgcggctgcccgtgcgcatcgcgcggcagggcggcgtgccgcgtgcgggcgaggtg
ctgctggccgccaccaacgatcacctgagcctgtcgccgcgcggcgtgctcggctatacg
cggcacccggtcgacacgccgtaccggccgtcgatcgacgtgttcttcaccagcgtcgcc
gacggctggcggggcgacgcgctcggcgtgctgctgacgggcatggggcgcgacggcgcg
ctggggttgaaggcgatgcgcgcgaagggctgctacacgatcgcgcaggacgaggcgacc
agtgcggtgtacgggatgccgaaggccgccgcggcgatcggcgcggcggctgcgatcctg
ccgctcgagcgcatcgcgccgcggctcatctcgcgcgtgatgcgccgctcgcccgactga

DBGET integrated database retrieval system