KEGG   Burkholderia sp. KJ006: MYA_4054Help
Entry
MYA_4054          CDS       T02110                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00020  Citrate cycle (TCA cycle)
buk00190  Oxidative phosphorylation
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Module
buk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
buk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
buk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYA_4054
   00650 Butanoate metabolism
    MYA_4054
  Energy metabolism
   00190 Oxidative phosphorylation
    MYA_4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFJ88412
UniProt: I2DUT6
Position
2:1213943..1214311
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgctcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgtttttcggcgcgcatgacttctcgtacgaaggctgggcatcgatcttctcc
gcgcaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system