KEGG   Burkholderia sp. KJ006: MYA_4222Help
Entry
MYA_4222          CDS       T02110                                 

Definition
Alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MYA_4222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_4222
  Lipid metabolism
   00071 Fatty acid degradation
    MYA_4222
  Amino acid metabolism
   00350 Tyrosine metabolism
    MYA_4222
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MYA_4222
   00626 Naphthalene degradation
    MYA_4222
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MYA_4222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1412027..1413055
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKATGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCHTGWETLCHGQENTGYSV
NGSYAEYVLADPNYVGHLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDVSPAKLELARQLGAELTIDASVDDPAKVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDIFTRLREGKIDGRIVLTDMQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaccatgaaagcggccgtcgttcacgcattcggcgaaccgttgcgtatcgag
gaagtcccggtgccgacgcccggccccggccagattctcgtcaacatcaaggcgacgggc
gtctgccataccgacctgcacgccgccgacggcgactggcccgtgaagccgacgctgccg
ttcattcccggccacgaaggggtcggcatcgtcgcggcggtcggcgcgggcgtcacgcat
gtgcgcgaaggcgatcgcgtcggcgtgccgtggctgtacaccgcgtgcggccattgcgag
tactgccacacgggctgggaaacgctgtgccacggacaggagaacacgggctactcggtc
aacggtagctacgcggaatacgtgctggccgatccgaactacgtcggccatctgccggcg
caggtcgccttcgacgagatcgcgccgatcctgtgcgcgggcgtgacggtctacaagggc
attcgcgtcaccgatacgcgtccgggccagtggctcgcgatttccggcatcggcggcctc
ggccacgtggccgtgcagtacgcgcgggcgatgggcctgcacgtcgcggccatcgacgtg
tcgccggcgaagctcgagctcgcgcggcagctgggcgcggagctgacgatcgacgcatcg
gtcgacgatccggcgaaggtcatccagaaggaaatcggcggtgcgcacggcgtgctggtc
acggccgtatcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtcgcgctcaacggcttgccgccgggcgattttccgctgccgatcttctcgaccgtgctg
aacggcatcacggtgcgcggctcgatcgtcggcacgcgccgcgatctgcaggagtcgctc
gatttcgctgcggacggcctcgtgcgcgcgcatatccatcgcgaccggctcggcaacatc
aacgacatcttcacccgtttgcgcgaagggaagatcgacgggcgcatcgtgctgaccgac
atgcagtga

DBGET integrated database retrieval system