KEGG   Burkholderia sp. KJ006: MYA_4222Help
Entry
MYA_4222          CDS       T02110                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00071  Fatty acid degradation
buk00350  Tyrosine metabolism
buk00625  Chloroalkane and chloroalkene degradation
buk00626  Naphthalene degradation
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_4222
  Lipid metabolism
   00071 Fatty acid degradation
    MYA_4222
  Amino acid metabolism
   00350 Tyrosine metabolism
    MYA_4222
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MYA_4222
   00626 Naphthalene degradation
    MYA_4222
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MYA_4222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AFJ88579
UniProt: I2DVA3
Position
2:1412027..1413055
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKATGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCHTGWETLCHGQENTGYSV
NGSYAEYVLADPNYVGHLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDVSPAKLELARQLGAELTIDASVDDPAKVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDIFTRLREGKIDGRIVLTDMQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaccatgaaagcggccgtcgttcacgcattcggcgaaccgttgcgtatcgag
gaagtcccggtgccgacgcccggccccggccagattctcgtcaacatcaaggcgacgggc
gtctgccataccgacctgcacgccgccgacggcgactggcccgtgaagccgacgctgccg
ttcattcccggccacgaaggggtcggcatcgtcgcggcggtcggcgcgggcgtcacgcat
gtgcgcgaaggcgatcgcgtcggcgtgccgtggctgtacaccgcgtgcggccattgcgag
tactgccacacgggctgggaaacgctgtgccacggacaggagaacacgggctactcggtc
aacggtagctacgcggaatacgtgctggccgatccgaactacgtcggccatctgccggcg
caggtcgccttcgacgagatcgcgccgatcctgtgcgcgggcgtgacggtctacaagggc
attcgcgtcaccgatacgcgtccgggccagtggctcgcgatttccggcatcggcggcctc
ggccacgtggccgtgcagtacgcgcgggcgatgggcctgcacgtcgcggccatcgacgtg
tcgccggcgaagctcgagctcgcgcggcagctgggcgcggagctgacgatcgacgcatcg
gtcgacgatccggcgaaggtcatccagaaggaaatcggcggtgcgcacggcgtgctggtc
acggccgtatcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtcgcgctcaacggcttgccgccgggcgattttccgctgccgatcttctcgaccgtgctg
aacggcatcacggtgcgcggctcgatcgtcggcacgcgccgcgatctgcaggagtcgctc
gatttcgctgcggacggcctcgtgcgcgcgcatatccatcgcgaccggctcggcaacatc
aacgacatcttcacccgtttgcgcgaagggaagatcgacgggcgcatcgtgctgaccgac
atgcagtga

DBGET integrated database retrieval system