KEGG   Burkholderia sp. KJ006: MYA_4340Help
Entry
MYA_4340          CDS       T02110                                 

Definition
methylamine utilization protein mauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
buk  Burkholderia sp. KJ006
Brite
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MYA_4340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1536088..1537437
Genome map
AA seq 449 aa AA seqDB search
MLRRAAFVLAAAVLGYGAFAVAFPARTPAAIGEVVANWTGANPHPVVLQRPPVQPLSAVA
QLGRALFFDPSLSASGKQSCASCHSPDRAYGPPNALDVQPGGLTMTQQGYRPPPSLMYLY
RQPNFSIGPDAGENDAAPSVAQQAASAAGVVKAQKVAGTAAAPQLVPQGGMFWDGRADTL
QQQAFGPLLNPVEMANASIDDVARKLAQSPHRARFEQLFGPRVFASSQLVVSEAMFAIAR
YQVEDRSFHPYDSKYDRWLEGRARLTQTELRGLRLFNDPAKANCAGCHLSQPGKDGLPPM
FTDYQYEALGVPRNRALAANRNPAFHDLGVCGPFRDDLKDQTQYCGMFLTPTLRNAATRQ
VFFHNGVFHTLDQVMAFYNERSIAPQKFYPRGADGKVDEYDDIPPQYRANVDVTDAPFDR
KPGDRPAMTEQDIKDIEAFLGTLTDAPQK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgccgcgcggccttcgtgctcgccgcggccgtgctcggctacggcgccttcgcg
gtcgcgtttccggcgcgcacgccggccgcgatcggcgaggtcgtcgcgaactggaccggc
gccaatccgcatcccgtggtgctgcagcggccgcccgtgcagccgctgtccgcggtcgcg
cagctcgggcgcgcgctgttcttcgatccgtcgctgtcggcatcgggcaagcagtcgtgc
gcgtcgtgccacagccccgaccgcgcttacgggccgccgaacgcgctcgacgtgcagccc
ggcggcctcacgatgacgcagcagggctaccgcccgccgccgtcgctgatgtatctgtac
cggcagccgaatttcagcatcggccccgatgcgggcgaaaacgacgcggcgccgagcgtc
gcgcagcaggcggcgtcggctgccggcgtggtcaaggcgcagaaggtggccggcacggcg
gccgcgccgcaactcgtgccgcaaggcggcatgttctgggacggccgcgccgacacgctg
cagcagcaggcgttcgggccgctgctgaacccggtcgagatggccaacgcgagcatcgac
gacgtcgcgcgcaagctcgcgcagtcgccgcatcgcgcgcgcttcgagcagttgttcggc
ccgcgcgtgttcgcgagctcgcagctcgtcgtatcggaggcgatgttcgcgattgcgcga
taccaggtcgaggaccggtcgttccatccgtacgacagcaagtacgatcgctggctggaa
ggccgcgcgcgcctcacgcagaccgagctgcgcgggctgcggctcttcaacgatccggcc
aaggccaactgtgccggctgccatctgtcgcagccgggcaaggacggcctgccgccgatg
ttcaccgactaccagtacgaggcgctcggcgtgccgcgcaaccgcgcgctcgcggcgaac
cgcaacccggcgttccacgatctcggcgtgtgcgggccgttccgcgacgacctgaaggac
cagacgcagtactgcgggatgttcctcacgccgacgctgcgcaacgcggcgacgcgccag
gtgttcttccacaacggcgtgttccacacgctcgatcaggtgatggcgttctacaacgag
cgcagcatcgcgccgcagaagttctatccgcgcggcgcggacggcaaggtcgacgaatac
gacgacattccgccgcaataccgcgcgaacgtcgacgtgaccgatgcgccgttcgaccgc
aagcccggcgaccggcccgcgatgaccgagcaggacatcaaggacatcgaggcgttcctc
ggcacgctgaccgacgcgccgcagaagtag

DBGET integrated database retrieval system