KEGG   Burkholderia sp. KJ006: MYA_4680Help
Entry
MYA_4680          CDS       T02110                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
buk  Burkholderia sp. KJ006
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYA_4680
   00052 Galactose metabolism
    MYA_4680
   00500 Starch and sucrose metabolism
    MYA_4680
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_4680
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MYA_4680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1910951..1911838)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSNVDCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIAREDSRSYGVVEGREWE
EDIIKLAGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRRIKPGAGGELQLTDAVQSLLA
NEQVLAYRYYGTRFDCGSKLGYLKATVEFALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctccca
gcaacgaaggcgagcccgaaggaaatgctgcctgtcgtggacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgcaggtatcacggagatgatcttcgtgacggggcgcagc
aagcgcgcgatcgaggatcatttcgacaagtcatacgaaatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagcaacgtggactgc
ttctacgtgcgtcagccggaagcgctcgggctcggccatgcggtgctgtgcgcggaaaag
ctcgtgcacggcgagccgttcgcggtgattctcgcggacgatctgctgcacggcgagcag
ccggtgctcaagcagctcgtcgacgtgttcgaccactaccacagctcggtgatcggggtc
gagacgatcgcgcgcgaggacagccgctcgtacggcgtcgtcgagggccgcgaatgggaa
gaggacatcatcaagctggcgggcatcatcgagaagccggcgccggaagatgcgccgtcg
aacctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcatctgcgccgg
atcaagccgggcgcgggcggcgagctgcagctcaccgacgccgtgcagtcgctgctcgcg
aacgaacaggtgctcgcgtaccgctactacggcacgcgtttcgattgcggcagcaagctc
ggctacctgaaggcaaccgtcgagttcgcgcttcagcatccggaagtgagccgcgaattc
gaggcgtatctgcgtacctgtctgccggcgctcgctgccgtcgcataa

DBGET integrated database retrieval system