KEGG   Burkholderia sp. KJ006: MYA_4695Help
Entry
MYA_4695          CDS       T02110                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00260  Glycine, serine and threonine metabolism
buk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01130  Biosynthesis of antibiotics
buk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYA_4695
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYA_4695
Enzymes [BR:buk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYA_4695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AFJ89048
UniProt: I2DWM2
Position
2:complement(1930829..1931647)
Genome map
AA seq 272 aa AA seqDB search
MSNRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMA
DGPVIQRSSERALARGVTLKTVLADVKRFRETDQKTPVVLMGYANPIERMGVDAFATEAH
AAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSL
KGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQL
LESAAPEGAAAALKSFIAELRAALDGAGKTAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccgtatccagcagaccttcgcggcgctcgccgaacaaggccgcaagggcctg
atcccgttcatcacggccggcgatcccgatcccgcgaagaccgtcgagttcatgcacgcg
ctcgccgcgggcggcgccgacgtgatcgagctcggcgtgccgttctcggacccgatggcc
gacggcccggtgatccagcgctcgtcggagcgcgcgctcgcgcgcggcgtcacgctcaag
accgtgctcgccgacgtgaagcgctttcgcgagaccgaccagaaaacccccgtcgtgctg
atgggttatgcgaacccgatcgagcggatgggcgtcgacgcgttcgcgaccgaagcccac
gcggcgggcgtcgacggcgtgctcgtggtcgactatccgcccgaggaagccggcgtgttc
gccgagaaaatgcgcgccgcgcagatcgatccgatcttcctgctcgcgccgacgtcgacc
gacgaacgcatcgcggacgtgggcaagatcgcgagcggctacgtgtactacgtgtcgctg
aagggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggcc
atcaagtcgcgcgtgccggttccggtgggcgtcggcttcggcatccgcgacgccgaaacg
gcgcgcgcggtggccgaagtgtcggatgccgtcgtgatcggcagccgtctggtgcaattg
ctggaaagcgccgcaccggaaggcgccgccgccgcgctgaagtcgttcatcgccgagctg
cgcgccgcgctggacggcgccggcaagacggcgcgataa

DBGET integrated database retrieval system