KEGG   Burkholderia sp. KJ006: MYA_4697Help
Entry
MYA_4697          CDS       T02110                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYA_4697
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYA_4697
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYA_4697
Enzymes [BR:buk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYA_4697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1932598..1933791)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDHGHFGPYGGVFVAETLIHALDELRAAYEKFRNDPEFVAEYERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECRVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGEGLASGHHAASLIAGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVAITDEEALKAFHDCCRIEGIIPALESSHALAY
AVKLAPTLPKDKILLVNLSGRGDKDMHTVAERTGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctccctgatgatcacggccacttcggcccgtatggcggcgtattcgtcgcc
gaaacgctgattcacgcgctggacgaactgcgcgccgcgtacgaaaaattccgcaatgac
cccgaattcgtcgccgagtacgagcgcgagctcaagtacttcgtcggccggccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggcgcggaa
gacgtgcgccgccaggccgccaacgtttaccggatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctcaacgaggcgatgcgcgactgg
gtcacgaacatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcatccgtat
ccggcgatggtgcgcgacttccagcgcgtgatcggcgacgagtgccgcgtgcagatgccg
gagctggccggccgtcaaccggacgcggtgatcgcgtgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgacacgtcggtgcagctgatcggcgtcgaagcg
gccggcgagggcctcgcgtcgggccatcacgcggcatcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgagaacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggcgtcggccccgagcacgcatggctgaag
gacagcggccgcgcgcagtacgtggcgatcaccgacgaagaagcgctgaaggcgttccac
gactgctgccggatcgaagggatcattccggcgctggagtcgagccatgcgcttgcatat
gccgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacaccgtcgccgagcgaacgggcatcgcgctctga

DBGET integrated database retrieval system