KEGG   Burkholderia sp. KJ006: MYA_4777Help
Entry
MYA_4777          CDS       T02110                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
buk  Burkholderia sp. KJ006
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:buk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2023541..2024518)
Genome map
AA seq 325 aa AA seqDB search
MTGSTMTELLHGDGAIRRTTPYGSSIENTYAGVLSFMRRNYSRVLDGVDVAISGVPLDLA
TTYRSGARLGPAAIRAASVQLAELHPYPWGFDPFDDLAAVDYGDCWFDAHNPLSIKPAIV
EHARTILRSGAKMLTLGGDHYITYPLLVAHAERYGRPLSLIHFDAHCDTWADDEPDSLNH
GTMFYKAVKEGLIDPATSVQVGIRTWNDDFLGIERLDAAWVHDHGARAAVERIVGIVGAR
PAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLSAVDLIGADVVEVAPAYDHAD
ITAIAAAHVACDLLCLWRQKKVAGR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacaggttccaccatgaccgaacttctgcatggcgacggcgcgatccgtcgcacgacg
ccgtacggctcgtcgatcgagaacacctacgcgggcgtgctgtcgttcatgcgccgcaac
tattcgcgtgtgctcgacggcgtcgacgtcgcgatttccggcgtgccgctcgatctcgcg
acgacctatcgctccggcgcgcggctcgggccggccgcgatccgcgcggcgagcgtgcag
ctcgcggagctgcatccgtatccgtggggcttcgacccgttcgacgatctcgcggccgtc
gactacggcgactgctggttcgacgcgcacaatccgctgtcgatcaagccggcgatcgtc
gagcatgcgcgcacgatcctgcgctcgggcgcgaagatgctcacgctcggcggcgatcac
tacatcacgtatccgctgctggtcgcgcatgcggagcgctacggccgtccgctgtcgctg
attcatttcgacgcgcactgcgatacctgggccgacgacgaaccggacagcctcaatcac
ggcacgatgttctacaaggcggtgaaggaagggctgatcgatccggcgacgtcggtgcag
gtcggcatccgcacgtggaacgacgacttcctcggcatcgagcggctcgatgccgcgtgg
gtgcatgaccatggcgcgcgcgcggcggtcgagcgcatcgtcgggatcgtcggcgcgcgg
cccgcctatctgaccttcgatatcgactgtctcgacccggcgttcgcgcccggcacgggc
acgccggttgccggcgggctgtcgtccgcgcaggcgctggcgatcgtgcgcgggctcagc
gcggtggatctgatcggcgcggatgtggtcgaggtcgcgccggcatacgaccatgcggac
atcacggcgatcgcggccgcgcacgtcgcgtgtgatctgctgtgtctgtggcggcagaag
aaggtggctggacgctga

DBGET integrated database retrieval system