KEGG   Burkholderia sp. KJ006: MYA_4925Help
Entry
MYA_4925          CDS       T02110                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
buk  Burkholderia sp. KJ006
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MYA_4925
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYA_4925
Enzymes [BR:buk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MYA_4925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2189496..2190791
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFASRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VGRAGPDGEDYTQSVDKQGLAKQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIDQITTNGHVIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPEFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSIDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctgcgcgacgcgatgcgccgcctcaacatgacgcgc
gaagcgttcgcgagccgcatcggcgtgagccgccgtgcgctcgatacgtggctgctgccc
gacgattcgcaggaatcgcgcggcatgcccgagatcgtcgagcgcttcgtctcggaaatc
gtcgggcgggccggcccggatggcgaagactatacgcaaagcgtagataagcaaggcctc
gcgaagcagttcctgttcgaaggcaagccgcagttgatctcggtggaccaattctcgcgc
gactcggtggaagcgctgttccgcgtcgccgacgtgatgcagccgatcgcgcgccgccac
aagatttcgcgcgtgctcgagggcgcggtgctcggcaacctgttcttcgaagcgagcacc
cgcacgcgcgtgtcgttcggggcggcgttctgccggctcggcggctcggtgtgcgacacc
accggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctacgtcgacgccctcgtgatccgccacccggagaagggctcggtggccgaa
ttcgcgcgcgcgaccaacctgccggtgatcaacggcggcgacggccccggcgagcacccg
agccaggcgctgctcgacctttacacgatccagcgcgaattctcgcgcctgggcaagatc
gtcgacggcgcgcatatcgcgctcgtcggcgacctgaaatacggccgcaccgtccattcg
ctcgtcaagctgctggcgctgtatcgcgggctgaagttcacgctggtgtcgccgccgacg
ctcgagatgcccgcgtacatcatcgatcagatcacgacgaacggtcacgtgatcgagcag
accaacgacctcgcggccggactgcgcggcgcggacgtcgtctacgcgacgcggatccag
aaggagcgcttcaccgacgaatcgttcgaaggctacacgccggaattccagatcaaccag
gcgctcgtcgactccgtatgcaagcccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggcgcgaacgacctgtccatcgacctgaaccgcgatccgcgcctcgcaatc
ttccgccagaccgacaacggcatccccgtgcgaatggcgatcttcgcggtgctgctcggc
gtcgagaatctggttcagcactcgatgcgcgacgcgacgtggcgcccgcctgcgtatctc
gggccggaggacgcggtgttccacgggatcgattga

DBGET integrated database retrieval system