KEGG   Burkholderia sp. KJ006: MYA_5003Help
Entry
MYA_5003          CDS       T02110                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00360  Phenylalanine metabolism
buk00362  Benzoate degradation
buk00620  Pyruvate metabolism
buk00621  Dioxin degradation
buk00622  Xylene degradation
buk00650  Butanoate metabolism
buk01100  Metabolic pathways
buk01120  Microbial metabolism in diverse environments
buk01220  Degradation of aromatic compounds
Module
buk_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYA_5003
   00650 Butanoate metabolism
    MYA_5003
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MYA_5003
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYA_5003
   00622 Xylene degradation
    MYA_5003
   00621 Dioxin degradation
    MYA_5003
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MYA_5003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFJ89351
UniProt: I2DXH5
Position
2:complement(2283018..2283965)
Genome map
AA seq 315 aa AA seqDB search
MATDNTRCKAAIIGSGNIGTDLMIKIMRSGKHLEIAAMVGIDPASDGLARAARLGVATTH
EGVEGLARLPVFDEIDFVFDATSAGAHVKNDAFLRALKPGIRMIDLTPAAIGPYCVPVVN
LDAHLDAPNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTE
TTSKALEAVGGAGKGKAIIVLNPAEPPLMMRDTVYLLSEAVDRALIEASVSEMAAAVQAY
VPGYRLKQSVQFDDIPAAAPVHIPGLGRFSGLKTSIFVEVEGAAHYLPAYAGNLDIMTSA
ALATAERMAASLVNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacaacacccggtgcaaggccgcgatcatcggctccggcaacatcggcacc
gacctcatgatcaagatcatgcgcagcggcaagcacctcgaaatcgccgcgatggtcggc
atcgatccggcctcggacggcctcgcgcgcgccgcgaggctcggcgtggcgacgacgcat
gaaggcgtggaagggctcgcgcgcctgcccgtgttcgacgagatcgacttcgtgttcgat
gcgacgtcggccggcgcacatgtgaagaacgacgcgttcctgcgcgcgctcaagcccggc
attcggatgatcgacctgacgcccgctgccatcggcccgtactgcgtgccggtggtgaat
ctcgacgcgcatctcgatgcgccgaacgtgaacatggtcacctgcggcgggcaggcgacg
atcccgatggtcgccgcggtgtcgcgcgtcgcaaaggtgcattacgcggagatcgtcgcg
tcgatcagcagcaagtcggcagggccgggcacgcgcgccaacatcgacgagttcacggag
acgacgtcgaaggcgctcgaagcggtcggcggtgccggcaagggcaaggcgatcatcgtg
ctcaatccggccgagccgccgctcatgatgcgcgacacggtgtatctgctgtccgaagcg
gtggaccgcgcgctgatcgaagcgtcggtcagcgagatggccgctgcggtccaggcctat
gtgcccggctatcggctgaaacagtccgtgcagttcgacgacatccccgccgctgcgccg
gtgcatatccccggactcggccgtttcagcggacttaagacttcgatcttcgtcgaagtg
gaaggcgcggcgcattatctgccggcctacgccggcaatctcgacatcatgacgtccgcc
gcgctggcaacggccgagcgcatggccgcgtcgctcgtgaacgcctga

DBGET integrated database retrieval system