KEGG   Burkholderia sp. KJ006: MYA_5003Help
Entry
MYA_5003          CDS       T02110                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
buk  Burkholderia sp. KJ006
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MYA_5003
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYA_5003
   00650 Butanoate metabolism
    MYA_5003
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MYA_5003
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYA_5003
   00622 Xylene degradation
    MYA_5003
   00621 Dioxin degradation
    MYA_5003
Enzymes [BR:buk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MYA_5003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2283018..2283965)
Genome map
AA seq 315 aa AA seqDB search
MATDNTRCKAAIIGSGNIGTDLMIKIMRSGKHLEIAAMVGIDPASDGLARAARLGVATTH
EGVEGLARLPVFDEIDFVFDATSAGAHVKNDAFLRALKPGIRMIDLTPAAIGPYCVPVVN
LDAHLDAPNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTE
TTSKALEAVGGAGKGKAIIVLNPAEPPLMMRDTVYLLSEAVDRALIEASVSEMAAAVQAY
VPGYRLKQSVQFDDIPAAAPVHIPGLGRFSGLKTSIFVEVEGAAHYLPAYAGNLDIMTSA
ALATAERMAASLVNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacaacacccggtgcaaggccgcgatcatcggctccggcaacatcggcacc
gacctcatgatcaagatcatgcgcagcggcaagcacctcgaaatcgccgcgatggtcggc
atcgatccggcctcggacggcctcgcgcgcgccgcgaggctcggcgtggcgacgacgcat
gaaggcgtggaagggctcgcgcgcctgcccgtgttcgacgagatcgacttcgtgttcgat
gcgacgtcggccggcgcacatgtgaagaacgacgcgttcctgcgcgcgctcaagcccggc
attcggatgatcgacctgacgcccgctgccatcggcccgtactgcgtgccggtggtgaat
ctcgacgcgcatctcgatgcgccgaacgtgaacatggtcacctgcggcgggcaggcgacg
atcccgatggtcgccgcggtgtcgcgcgtcgcaaaggtgcattacgcggagatcgtcgcg
tcgatcagcagcaagtcggcagggccgggcacgcgcgccaacatcgacgagttcacggag
acgacgtcgaaggcgctcgaagcggtcggcggtgccggcaagggcaaggcgatcatcgtg
ctcaatccggccgagccgccgctcatgatgcgcgacacggtgtatctgctgtccgaagcg
gtggaccgcgcgctgatcgaagcgtcggtcagcgagatggccgctgcggtccaggcctat
gtgcccggctatcggctgaaacagtccgtgcagttcgacgacatccccgccgctgcgccg
gtgcatatccccggactcggccgtttcagcggacttaagacttcgatcttcgtcgaagtg
gaaggcgcggcgcattatctgccggcctacgccggcaatctcgacatcatgacgtccgcc
gcgctggcaacggccgagcgcatggccgcgtcgctcgtgaacgcctga

DBGET integrated database retrieval system