KEGG   Burkholderia sp. KJ006: MYA_5107Help
Entry
MYA_5107          CDS       T02110                                 

Definition
(GenBank) Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
buk  Burkholderia sp. KJ006
Pathway
buk00010  Glycolysis / Gluconeogenesis
buk00620  Pyruvate metabolism
buk00640  Propanoate metabolism
buk00680  Methane metabolism
buk01100  Metabolic pathways
buk01110  Biosynthesis of secondary metabolites
buk01120  Microbial metabolism in diverse environments
buk01130  Biosynthesis of antibiotics
buk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_5107
   00620 Pyruvate metabolism
    MYA_5107
   00640 Propanoate metabolism
    MYA_5107
  Energy metabolism
   00680 Methane metabolism
    MYA_5107
Enzymes [BR:buk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MYA_5107
Lipid biosynthesis proteins [BR:buk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MYA_5107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFJ89455
UniProt: I2DXS9
Position
3:50448..52109
Genome map
AA seq 553 aa AA seqDB search
MRNGATARAAPAYADAVAGFRIETAATQLHGNLEQGLNACVECCDRHAAANPDAIALDWI
DAGGRHRSYTFAQMLALSARVANLLVEQGVQPGDVVAGMLPRTPELVATILGTWRAGAVY
QPLFTAFGPKAIEHRLRMSHARVVVTNVANRGKLDEVADCPRIATVRGEALPAGDIDFRA
ALDAQPDAFEPVLRKGADLFMMMSTSGTTGLPKGVPVPLRALLAFGAYMRHAIDLRPSDR
FWNIADPGWAYGLYYAITGPLLLGHATTLYEGGFTVDSTYDVIERLGITSLAGSPTAYRM
LMAAGPEAATRVKGKLRVVSSAGEPLNPEVVRWFDAVLDAPIYDHYGQTELGMVVNNHHG
LAHVVHTGSAGLAMPGYRVAVLDEAGRELGPGEPGNLAIDIARSPLLWFDGYWQQATPAI
AGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGPFDVESALIEHPAVSEAAVIGVP
DPERTEIVKAFVVLSKGFEGTPALADELSQHVKRRLSAHAYPRAIDFVDALPKTPSGKIQ
RFVLRKMEAEKAA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatggagcaaccgcccgggcggcgccggcctacgccgacgccgttgccggcttc
cgtatcgagacggccgccacgcaactgcacggcaacctcgagcagggtctgaacgcctgc
gtcgaatgttgcgaccgccatgccgcggcgaaccccgacgccatcgcgctcgactggatc
gatgccggcggccgacaccgcagctatacgttcgcgcagatgctcgcgctgtcggcgcgc
gtcgcgaacctgctggtcgagcagggcgtgcagcccggcgacgtggtggccggcatgttg
ccgcgtacgcccgaactggtcgcgacgatcctcggcacgtggcgcgccggcgccgtctat
cagccgcttttcaccgcgttcgggccgaaggcgatcgaacatcggttgcgcatgagccac
gcacgcgtcgtcgtcaccaacgtcgcgaatcgcggcaagctcgacgaggtcgcggattgc
ccgcgaatcgcgaccgtgcgcggcgaggcgctcccggccggcgacatcgacttccgtgcc
gcgctcgacgctcagcccgacgcgttcgagccggtgctgcgcaagggcgccgatctgttc
atgatgatgtcgacgtcgggcacgacgggcctgccgaagggcgtgcccgtcccgctgcgc
gcgctgcttgcgttcggcgcgtatatgcggcacgcgatcgacctgcgtcccagcgatcgc
ttctggaacatcgccgatccgggctgggcctatggcctctactacgcgatcaccggcccg
ctgctgctcggtcacgcgacgacgttgtacgaaggcggcttcacggtcgacagcacgtac
gacgtgatcgagcggctcggcatcacgagcctcgccggttcgccgaccgcataccggatg
ctgatggcggccggccccgaagctgcaacgcgcgtgaagggcaagctgcgcgtcgtgagc
agcgcgggcgaaccgctgaacccggaagtcgtgcgctggttcgacgccgtgctcgacgcg
ccgatctacgaccactacgggcagaccgaactcgggatggtcgtgaacaatcatcacggg
ctcgcgcacgtggttcataccgggtcggccgggctggcgatgcccggctatcgcgtcgcg
gtgctcgacgaagccggccgcgagctcggccccggcgagcccggcaatctcgcgatcgat
atcgcgcgctcgccgctgctgtggttcgacggctactggcagcaggcgacgccggcgatc
gcgggcggctactaccggaccggcgacaacgtcgagctcgagccggacggcaccgtgagc
ttcatcggacgcgcggacgacgtgatcacatcgtccggctaccggatcggcccgttcgac
gtcgaaagcgcgctgatcgagcacccggccgtgagcgaagcggcggtgatcggcgtgccg
gacccggagcgcaccgagatcgtgaaggccttcgtcgtgctgtcgaaaggcttcgaaggc
acgccggcgctggccgacgagttgagccagcacgtgaagcgacgtttgtccgcccacgca
tatccccgcgcgatcgacttcgtcgacgcgctgccgaaaaccccgagcggcaagatccag
cgcttcgtactgcgcaagatggaagctgaaaaggcggcttga

DBGET integrated database retrieval system