KEGG   Burkholderia sp. KJ006: MYA_5199Help
Entry
MYA_5199          CDS       T02110                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_5199
   00052 Galactose metabolism
    MYA_5199
Enzymes [BR:buk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MYA_5199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:162488..163795
Genome map
AA seq 435 aa AA seqDB search
MIDAAAFGRPYSFAAAVARDRRAPGRHADCVARWTQPFRRSSMNPLSTRRPVLAICACAT
FALGSNAGSTASAAAAAPDVSVSRADYGTTAAGQPVSQYTLANAHGVTLKIITYGGIVTA
LDVPDRNGKPADIVLGFDSLRDYEAHNGNIHFGALIGRYANRIARGRFVLDGKTWTLPVN
DPPNTLHGGPDSFDAKVWTVTRTRSDADGSSVTLRYVSPDGENGFPGTLTTDVTYTLTRD
DLIRIDYRATTDRDTVVNLTNHSYFNLAGHDSGSVERQLIEIAASRFTPIDATSIPTGAL
ASVAGTPMDLRQLTPIGAHLRDRDPQLAIAHGYDQNWVLDHGGQPAPAFAARAYDPASGR
FLEVYTTQPGLQFYTSNGLNGSVAGKGGTLYRQADAFALEAEHFPDSPNRPAFPTTVLKP
GETLHEVTVWRVGAR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatgcggccgccttcgggcggccgtattcgtttgcggcggccgtcgcgcgcgat
cgtcgcgcgcccggcaggcatgcggattgcgtggcgcgatggacacaaccgtttcggagg
tcgtccatgaacccgctctcgacacggcggccggtgctcgcgatctgtgcatgcgcaacg
tttgctctcggctcgaacgctgggtcgactgcatcggctgcagcggccgcgcccgacgtg
tccgtcagccgtgcggattacggcaccaccgcggccggccagccggtcagccagtacacg
ctcgccaacgcgcacggcgtgacgctgaagatcatcacgtacggcggcatcgtgacggcg
ctcgacgtgccggaccgcaacggcaagcccgccgatatcgtgctcggcttcgattcgctg
cgcgactacgaggcgcacaacggcaacatccatttcggtgcgttgatcggccgctatgcg
aaccgcatcgcacgcgggcgcttcgtgctcgacggcaagacctggacgctgccggtcaac
gatccgccgaatacgctgcatggcggccccgatagtttcgacgcgaaggtgtggacggtg
acgcgcacgcgcagcgacgccgacggttcgagcgtgacgctgcgttacgtgagccccgat
ggcgaaaacggctttccaggcacgctgactaccgacgtgacctacacgctgacgcgcgac
gacctgatccgcatcgactatcgcgcgacgacggaccgggacacggtcgtcaacctgacc
aaccacagctatttcaatctggccgggcacgacagcggcagtgtcgaacggcaactgatc
gagatcgccgcgtcgcgcttcacgccgatcgatgcgacgtcgattccgaccggcgcgctg
gcgagcgtggccggcacgccgatggacctgcgccagctgacgccgatcggcgcgcatctg
cgcgaccgtgatccgcagctcgccatcgcgcacggctacgaccagaactgggtgctcgac
cacggcggccagcccgcgccggcgttcgccgcgcgtgcgtacgatccggcatcggggcgg
tttctggaggtctacacgacgcagccggggctgcaattctatacgtccaacgggttgaac
ggcagcgtcgccggcaagggcggcacgctttaccggcaggccgacgcgttcgcgctggag
gccgagcattttcccgattcgccgaaccggccggcgttcccgacgaccgtgctcaaaccc
ggcgagacgctgcatgaggtgacggtgtggagggtgggggcgcggtga

DBGET integrated database retrieval system