KEGG   Burkholderia sp. KJ006: MYA_5322Help
Entry
MYA_5322          CDS       T02110                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
buk  Burkholderia sp. KJ006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:buk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(305378..307612)
Genome map
AA seq 744 aa AA seqDB search
MTTDVSIAELARAAGLEPDWTDAGGVARRVDDDALVALVDALGWPCGTPIERVDSAAALA
DARNAPPQLVTGDAGAPLALPHAIAPAGTRYRVTLESGTHVDGRIAASGESGTLAPLDEP
GYHTLDLGARRIALAIAPPRARPSAGERMPQTEGRWGIAAQLYGLRRTNDDGAGDYSALA
ELAAHAARHGAHAVAISPTHAGYPALPEHDSPYSPSSRRWHNVAYLDGEAVPGADFVRRT
LDPAAADGRAPDTPLIDWPHVLPLRLRRLRACFDAWRENGEPARDAFERFRAAGGAALDA
HARFDALQAFCIENGIGADWRQWPAQWRDPTSPEVDAFAQTHTDTIAFHTYLQWCASDAL
GRAQATARDAGMALGLIADLAVGSDCAGSDAWAHGTTLLRGVSVGAPPDLFNTDGQAWGV
TTWTPDALRATGFAPFIELLRAAFAHAGGIRIDHVLGLARLWIVPHGRSPRDGAYLRYPL
DDLLRIVALEAARHRAIAIGEDLGTVPAGFRERIAAQGIAGMRVLWFERDADGAFRPPSD
WDRDTVAMTSTHDLPTVAGWWRGVDLEWRRGAHAQRDDEPAHGAGGDVGLAAAAHGVDGA
DGDERNAPCLHDDADAGRDPSPPDPDLAAAAAGAETERAAERTALWRALQRAGCAAADQA
MPPPAAPPVDAVVAYVARSPSPLAIVPLEDLLALDAQPNLPGPPCGHPNWLRRLPRAIDA
LFDAPVRERIAAIERARPVRREDA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtatcgatcgccgagctcgcgcgcgccgcggggctcgaaccggactgg
accgacgcgggcggtgtcgcgcgtcgggtggacgacgacgcgctcgtcgcgctggtcgac
gcactcggctggccctgcggcacgccgatcgagcgcgtcgacagcgcggccgcgcttgcc
gatgcgcgcaacgcgccaccgcagctcgtcaccggcgacgccggtgcgccgctcgcgctg
ccacacgccatcgcgccggccggcacgcgctaccgggtcacgctcgaatcgggcacgcac
gtcgacgggcgcatcgcagcgagcggcgaatccggcacgctggcgccgctcgacgagccc
ggttatcacacgctcgacctcggcgcacgacgcattgcgctcgcgatcgcgccgccgcgc
gcgcgcccgtccgccggcgagcgcatgccgcaaaccgaaggacgctggggaatcgcagcg
cagctgtacgggctgcgccgcaccaacgacgacggcgccggcgactactcggcgctcgcc
gaactcgccgcgcacgcggcaaggcatggcgcgcacgcggtcgcgatcagcccgacgcac
gccggctatccggcgctgcccgagcacgacagcccgtattcgccgtcgtcgcggcgctgg
cacaacgtcgcgtatctcgacggcgaggcggtgccgggcgcggacttcgtgcgacgcacg
ctcgacccggccgccgccgacggccgcgcgcccgacacgccgctgatcgactggccgcac
gtgcttccgctgcgactgcggcgcctgcgtgcgtgcttcgacgcctggcgcgaaaacggc
gagccggcgcgcgacgcattcgaacgattccgcgcggccggcggcgcggcgctcgacgcg
catgcgcgcttcgacgcgctgcaggcgttctgcatcgagaacgggatcggcgcggactgg
cggcaatggcccgcgcagtggcgagacccgacgtcgcccgaggtcgacgcgttcgcgcag
acccacacggacacgatcgccttccacacgtacctgcaatggtgcgcgtccgacgcgctc
ggccgcgcgcaggcgacggcgcgcgatgcagggatggcgctcgggttgatcgccgatctg
gcggtcggctccgattgcgcgggcagcgatgcatgggcgcacggcacgacgctgttgcgc
ggcgtgtcggtcggcgcgccgccggacctgttcaacaccgacggccaggcgtggggtgtg
acgacctggacgccggacgcgctgcgcgcgaccggcttcgcgccgttcatcgagctgctg
cgcgcggcgttcgcgcatgcgggcggcatccgtatcgatcacgtgctcggcctggcgcgg
ctgtggatcgtgccgcacggccgctcgccgcgcgacggcgcgtacctgcgctatccgctc
gacgatctgctgcgcatcgtcgcgttggaagcggcccggcatcgcgcgatcgcgatcggc
gaggatctcggcacggtgccggccggctttcgcgagcggatcgccgcgcagggcatcgcc
ggcatgcgcgtgctgtggttcgagcgcgacgccgacggcgcgttccggccgccgtcggac
tgggatcgcgacacggtcgcgatgacgtcgacgcacgatctgccgaccgtcgccggctgg
tggcgcggcgtcgatctcgaatggcggcgcggcgcgcacgcgcagcgggacgacgagcct
gcacacggcgcgggcggcgacgtcgggctggccgcggccgcgcatggcgtggatggcgcg
gatggcgatgaacgcaacgcgccgtgcttgcacgacgacgccgacgccggccgcgatccg
tcgccacccgatcccgacctcgcggcggctgccgccggcgcggaaaccgagcgcgcggcc
gaacgcacggcgctgtggcgcgcgctgcagcgcgccggctgcgccgcggccgatcaggcc
atgccgccgcccgctgcgccgccggtcgacgcagtcgtcgcctacgtcgcgcgcagcccg
tcgccgctcgcgatcgtgccgctcgaagacctgctcgccctcgacgcgcagccgaacctt
cccggcccgccgtgcggccatccgaactggctgcggcggctgccgcgcgcgatcgacgcg
ctgttcgacgcgccggtgcgcgagcgcatcgccgcgatcgaacgcgcacgccctgtgcgc
cgggaggacgcatga

DBGET integrated database retrieval system