KEGG   Burkholderia sp. KJ006: MYA_5325Help
Entry
MYA_5325          CDS       T02110                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
buk  Burkholderia sp. KJ006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYA_5325
Enzymes [BR:buk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYA_5325
Exosome [BR:buk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYA_5325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(312007..314208)
Genome map
AA seq 733 aa AA seqDB search
MTDTLFDRRDIDALLGGRHPDPFACLGPHGEAGRTVVRVLLPGALRVRAVTPGGDELGAL
ACVDDAGCFAGTITHDGRYRLAIDWPDAQQVTDDAYAFGTLLDDAALARFAAGDPAAVLD
CLGATPIRVDGVDGVRFAVWAPNAQRVSVVGNFNSWDGRRHPMRLRRPWGVWELFVPGIG
PGEHYKYELCAADGSLLPHKADPCARATEAPPRTASVVADTAALDGFGWHDAGWIDARPD
AGRRFRVPWSIYEVHAESWQRVPEEMDRSATWDELAERLIPYVKGMGFTHVEFMPISEYP
FGGSWGYQPLAQFAPSARFGPVDGFARFVDRAHAAGIGVIVDWVPAHFPNDAHGLAQFDG
SALYEHADPREGMHPDWNTCVFNLGRNEVSAFLIASALAWARRYHVDGIRVDAVASMLYR
DYSRKEGEWVPNVYGGRENLESVAFLRTLNDALHGAAAPAGVVTIAEESTAWPGVTAPTG
DGGLGFDFKWNMGWMHDTLAYLHEDPIHRRYHHDRMTFGLVYAFSERFVLPLSHDEVVHG
KGSLAAKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWSEFAHDATPHWDLLDA
PAHRGVQRLVRDLNRAYAAEPALHALDCDAAGFAWLIGDDRDNSVLAFARRDDSGRVVVA
ICNFTPVPRSGYRVGLPAPGQWRELMNTDAAVYGGTNAGNDGAVWAQDVPAHGQPWSATL
HLPPLATLWLTPA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctgttcgaccgccgcgatatcgacgccctgctcggcggccgccatccc
gatccgttcgcgtgtctcggcccgcacggcgaggccgggcgcacggtggtgcgcgtgctg
ctgcccggcgcgctgcgcgtgcgcgccgtgacgcccggcggcgacgagctcggcgcgctc
gcgtgcgtcgacgacgccggctgcttcgccggcacgatcacgcacgacggccgctaccgg
ctcgcgatcgactggcccgacgcgcagcaggtgaccgacgacgcctacgcattcggcacg
ctgctcgacgacgccgcgctggcccgcttcgcggccggcgacccggccgccgtgctcgac
tgcctcggcgcgacgcccatccgcgtagacggcgtcgacggcgtgcgcttcgcggtatgg
gcgccgaacgcgcagcgcgtgtcggtggtcggcaacttcaacagctgggacggccgccgc
cacccgatgcggctgcggcgcccgtggggcgtgtgggagctgttcgtgcccggcatcggc
cctggggagcactacaagtacgagctgtgcgcggccgatggcagcctgctgccgcacaag
gccgacccgtgcgcgcgcgcgaccgaggcgccgccgcgcaccgcgtcggtggtcgccgat
acggccgcgctcgacggcttcggatggcacgacgcgggctggatcgacgcgcggcccgac
gccgggcggcggttccgggtgccgtggtcgatctacgaggtgcatgccgagtcgtggcag
cgcgtgcccgaggaaatggaccgcagcgcgacgtgggacgagctcgcggagcggctgatt
ccgtacgtgaagggcatgggcttcacgcacgtcgaattcatgccgatctccgaatacccg
ttcggcggctcgtggggctatcagccgctcgcgcagttcgcgccttccgcgcgcttcggg
ccggtcgacggcttcgcgcgcttcgtcgaccgcgcgcatgcggccggcatcggcgtgatc
gtcgactgggtgcccgcgcattttccgaacgacgcgcacgggctcgcgcagttcgacggc
agcgcgctgtacgagcacgccgatccgcgcgaaggcatgcatccggactggaacacctgc
gtgttcaacctcgggcgcaacgaggtcagcgcgttcctgatcgcgtccgcgctcgcgtgg
gcgcgccgctatcacgtcgacgggatccgcgtcgacgcggtcgcctcgatgctgtaccgc
gactattcgcgcaaggaaggcgaatgggtgccgaacgtgtacggcgggcgcgagaacctc
gaatcggtcgcgttcctgcgcacgctcaacgacgcgctgcacggcgcggccgcgccggcg
ggcgtcgtcacgatcgccgaggagtcgaccgcgtggccgggcgtgaccgcgccgaccggc
gacggcggcctcggcttcgatttcaaatggaacatgggctggatgcacgacacgctcgcg
tatctgcacgaagacccgatccatcgccgctatcaccacgaccggatgacgttcgggctc
gtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgacgaggtcgtgcacggc
aagggctcgctcgccgcgaaaatgcccggcgacgcgtggcagcggctcgcgacgctgcgc
gcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctgttcatgggcagcgag
ttcgcgcaatggtcggagttcgcgcacgacgcgacgccgcactgggatctgctcgacgcg
cccgcgcaccgcggcgtgcagcggctcgtgcgcgacctgaaccgcgcgtatgcggccgag
ccggcgctgcatgcgctcgactgcgatgcggccggcttcgcgtggctgatcggcgacgat
cgcgacaacagcgtgctcgcgttcgcgcgccgcgacgacagcggccgcgtggtggtggcg
atctgcaacttcacgccggtgccgcgcagcggctatcgcgtcggcttgcccgcgcccgga
cagtggcgcgaactgatgaacaccgacgcggccgtgtacggcggcaccaacgccggcaac
gacggcgccgtgtgggcgcaggacgtgcccgcgcacggccagccgtggtcggcgacgttg
cacctgccgccgctcgcgacgctgtggctgacccccgcatga

DBGET integrated database retrieval system