KEGG   Burkholderia sp. KJ006: MYA_5666Help
Entry
MYA_5666          CDS       T02110                                 

Definition
Tagatose-6-phosphate kinase/1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYA_5666
   01230 Biosynthesis of amino acids
    MYA_5666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_5666
   00030 Pentose phosphate pathway
    MYA_5666
   00051 Fructose and mannose metabolism
    MYA_5666
   00052 Galactose metabolism
    MYA_5666
  Energy metabolism
   00680 Methane metabolism
    MYA_5666
Enzymes [BR:buk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYA_5666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(689138..690214)
Genome map
AA seq 358 aa AA seqDB search
MIERNRVRLRDRLTGINAATVAARMVEPRPARAPSRRACHRLHKTHTMTDIVTVTLNPAV
DVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYLAGGPTGDVLTLLI
EAERLPSVRIRIVGETRENVCVTETSTGREYRFLMPGPSVSDAEWRDCAARLDAMQPAPR
YLVLSGSLPPGAPDDLYATLARAAKARGSRVVVDASGRALGAALEEGVHLVKPSIGELSA
LAGEALDDASACRVASELVARGQAEIVALTLGARGAWVVTRDRSLRLPGRPAAVCSTVGA
GDSFVGGMVWALARGVPLDDACRYALAASASSVEHPGTALCTRADVERIHDEIVALAS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagcgcaatcgtgtgcggttgcgggatcgattgactggcatcaacgccgcgacc
gtcgccgcacgtatggtggagccacggccggcgcgcgcaccgtcgcggcgcgcgtgccat
cgactgcacaagacccacaccatgacagatatcgttaccgttaccctgaacccggccgtc
gacgtcgcgacgtcggtcgagcacatcgtcgacacgcacaagctgcgctgcgcgcggccg
cgccgcgacccgggcggcggcggcatcaacgtcgcgcggaccatccaccggctcggcggc
gactgcgtcgcgctgtacctggccggcggcccgaccggcgacgtgctgacgctgttgatc
gaggccgagcgcctgccgagcgtgcgcatccggatcgtcggcgagacgcgcgagaacgtc
tgcgtgaccgagacctcgaccgggcgcgaataccgctttttgatgccggggccatcggtg
agcgacgccgagtggcgcgactgcgcggcccgcctcgacgcgatgcagccggcgccgcgc
tatctcgtgctgagcggcagtctgccgcccggcgcgcccgacgatctgtacgcgacgctc
gcacgggccgcgaaggcgcggggcagtcgcgtcgtcgtcgacgcgtcgggccgtgcgctg
ggcgcggcgctggaggagggcgttcatctcgtgaagcccagtatcggcgaactcagcgcg
ctggccggcgaagcgctcgacgatgcgtccgcgtgccgagtggcgagcgaactcgtcgcg
cgcggccaggccgagatcgtcgcgttgacgctcggcgcgcgcggcgcgtgggtcgtcacg
cgcgatcggtcgttgcgtctgcccgggcggccggcagcggtatgcagcacggtcggcgcc
ggcgacagtttcgtcggcggcatggtgtgggcgctggcgcgcggcgtgccgctcgacgac
gcgtgccgctatgcgctcgccgcatcggcttcgtcggtcgagcatccgggcaccgccctg
tgcacgcgcgcggacgtcgagcgcatccacgacgaaatcgttgcgctcgcaagctga

DBGET integrated database retrieval system