KEGG   Burkholderia sp. KJ006: MYA_5666Help
Entry
MYA_5666          CDS       T02110                                 

Definition
Tagatose-6-phosphate kinase/1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:buk01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:buk01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:buk00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:buk00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:buk00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:buk00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:buk00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(689138..690214)
Genome map
AA seq 358 aa AA seqDB search
MIERNRVRLRDRLTGINAATVAARMVEPRPARAPSRRACHRLHKTHTMTDIVTVTLNPAV
DVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYLAGGPTGDVLTLLI
EAERLPSVRIRIVGETRENVCVTETSTGREYRFLMPGPSVSDAEWRDCAARLDAMQPAPR
YLVLSGSLPPGAPDDLYATLARAAKARGSRVVVDASGRALGAALEEGVHLVKPSIGELSA
LAGEALDDASACRVASELVARGQAEIVALTLGARGAWVVTRDRSLRLPGRPAAVCSTVGA
GDSFVGGMVWALARGVPLDDACRYALAASASSVEHPGTALCTRADVERIHDEIVALAS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagcgcaatcgtgtgcggttgcgggatcgattgactggcatcaacgccgcgacc
gtcgccgcacgtatggtggagccacggccggcgcgcgcaccgtcgcggcgcgcgtgccat
cgactgcacaagacccacaccatgacagatatcgttaccgttaccctgaacccggccgtc
gacgtcgcgacgtcggtcgagcacatcgtcgacacgcacaagctgcgctgcgcgcggccg
cgccgcgacccgggcggcggcggcatcaacgtcgcgcggaccatccaccggctcggcggc
gactgcgtcgcgctgtacctggccggcggcccgaccggcgacgtgctgacgctgttgatc
gaggccgagcgcctgccgagcgtgcgcatccggatcgtcggcgagacgcgcgagaacgtc
tgcgtgaccgagacctcgaccgggcgcgaataccgctttttgatgccggggccatcggtg
agcgacgccgagtggcgcgactgcgcggcccgcctcgacgcgatgcagccggcgccgcgc
tatctcgtgctgagcggcagtctgccgcccggcgcgcccgacgatctgtacgcgacgctc
gcacgggccgcgaaggcgcggggcagtcgcgtcgtcgtcgacgcgtcgggccgtgcgctg
ggcgcggcgctggaggagggcgttcatctcgtgaagcccagtatcggcgaactcagcgcg
ctggccggcgaagcgctcgacgatgcgtccgcgtgccgagtggcgagcgaactcgtcgcg
cgcggccaggccgagatcgtcgcgttgacgctcggcgcgcgcggcgcgtgggtcgtcacg
cgcgatcggtcgttgcgtctgcccgggcggccggcagcggtatgcagcacggtcggcgcc
ggcgacagtttcgtcggcggcatggtgtgggcgctggcgcgcggcgtgccgctcgacgac
gcgtgccgctatgcgctcgccgcatcggcttcgtcggtcgagcatccgggcaccgccctg
tgcacgcgcgcggacgtcgagcgcatccacgacgaaatcgttgcgctcgcaagctga

DBGET integrated database retrieval system