KEGG   Burkholderia sp. KJ006: MYA_5850Help
Entry
MYA_5850          CDS       T02110                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
buk  Burkholderia sp. KJ006
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:buk00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:buk00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(897899..899221)
Genome map
AA seq 440 aa AA seqDB search
MSYFEHIPAIRYEGPQSDNPLAYHHYDPDKHVLGKTLAEHLRIAVCYWHTFVWPGHDMFG
QGTFVRPWQQPGDPLERARMKADAAFEFFSKLGTPFYTFHDTDVAPEGDNLREYAANFAR
MVDYLGERQQASGVRLLWGTANLFSHPRFAAGAATNPNPDVFAWAATQVRHALDATHRLG
GENYVLWGGREGYETLLNTDLKRERDQFARFLSMVVEHKHRIGFDGALLIEPKPQEPTKH
QYDYDVATVHGFLVQYGLQDEIRVNIEANHATLAGHSFHHEIANAFALGVFGSVDANRGD
PQNGWDTDQFPNSVEELTLAFYEILRHGGFTTGGMNFDAKVRRQSVAAEDLFYGHVGAID
VLALALERAAVLVENDRLDALRRQRYAQWDDAFGRKILSGGYTLQSLADDALARGVNPQH
VSGAQERLENIVNQAIYALR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttcgaacacattcccgcgattcgctacgaaggtccgcagtcggacaacccg
ctcgcctatcaccactacgaccccgacaagcacgtgctcggcaagacgctcgccgagcat
ctgcgcatcgcggtgtgctactggcacacgttcgtctggccgggccacgacatgttcggg
cagggcaccttcgtgcggccctggcagcagccgggcgacccgctcgagcgcgcgcggatg
aaggccgacgccgcgttcgaattcttctcgaagctcggcacgccgttctacacgttccac
gacaccgacgtcgcgccggaaggcgacaacctgcgcgagtacgctgcgaatttcgcgcgg
atggtcgactatctcggcgagcgccagcaggcgagcggcgtgcggctgctgtggggcacg
gcgaacctgttctcgcatccgcgcttcgcggccggcgcggcgaccaacccgaatcccgac
gtgttcgcatgggccgcgacgcaggtgcgtcacgcgctcgacgcgacgcaccggctcggc
ggcgagaactacgtgctgtggggcggccgcgaaggctacgagacgctgctcaataccgat
ctgaagcgcgagcgcgaccagttcgcgcggttcctgtcgatggtggtcgagcacaagcac
cggatcggtttcgacggcgcgctgctcatcgagccgaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgccacggtgcacggcttcctcgtgcagtacggcctgcaggac
gagatccgcgtgaacatcgaggcgaaccatgcgacgctcgccggccattcgttccatcac
gagatcgcgaatgcgttcgcgctcggcgtgttcggcagcgtcgacgcgaaccgcggcgat
ccgcagaacggttgggacaccgaccagttcccgaacagcgtcgaggagctgacgctcgcg
ttctacgagatcctgcggcacggcggcttcacgaccggcgggatgaacttcgacgcgaag
gtgcggcgccagagcgtcgcggcggaagacctgttctacggccacgtcggcgcgatcgac
gtgctcgcgctcgcgctcgaacgcgcggcggtgctggtcgagaacgaccggctcgacgcg
ctgcgccggcagcgctacgcgcagtgggacgacgcgttcggccgcaagatcctgtcgggc
ggctacacgctgcagtcgctcgccgacgacgcgctcgcgcgcggcgtgaacccgcagcac
gtgagcggcgcgcaggagcggctggagaacatcgtgaaccaggcgatctacgcgctgcgc
tga

DBGET integrated database retrieval system