KEGG   Burkholderia sp. KJ006: MYA_5852Help
Entry
MYA_5852          CDS       T02110                                 

Definition
D-xylose-specific 1-epimerase (mutarotase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:buk00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:buk00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:900704..901792
Genome map
AA seq 362 aa AA seqDB search
MRIDTDTSHPATDVGRIPSEPWGTLPGGDPVRRYTLRNAHGVRVVVSDLGATVVSWLAPD
RTGRFADIVLAHDTPAEYLDAGAYLGATIGRWANRIAAGRFTLDGIDYPLDRNENGNLLH
GGASGFHRARWDVIDDRGGLTLRLESPEGDAGFPGNVRVQVRYTLDDDGTLTIDYTGVTD
APTPLNLTNHSYFNLSGRAGGDVRGHLLQIDADAFVEVDDALIPTGTADVTGSAFDFRQS
APIGARLDWPHAQLARGRGFDHCYVLREPGGGVRTVASIYDPESGRELAVSTDQRGLQLY
TGNYLQGLRVSGGVVCTPHAALCVEAGYFPDQVNMDGLREETILRPGQVYRQTTRYRVGV
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgataccgacacttctcacccggcgaccgacgtcggccgcattccgtccgag
ccgtggggcacgctgcccggcggcgaccccgtgcggcgctatacgctgcgcaatgcgcac
ggcgtgcgcgtcgtcgtgagcgatctcggcgcgaccgtcgtgtcgtggctcgcgccggat
cgcaccgggcgcttcgccgacatcgtgctcgcgcacgacacgccggccgagtatctcgac
gcgggcgcgtacctcggcgcgacgatcggccgctgggccaaccggatcgccgccgggcgc
ttcacgctcgacggcatcgactatccgctcgaccgcaacgagaacggcaacctgctgcat
ggcggcgcgagcggctttcaccgtgcgcgctgggacgtgatcgacgaccgcggcgggctg
acgctgcggctcgagtcgccggaaggcgatgcggggtttcccggcaacgtgcgcgtgcag
gtccgttacacgctcgacgacgacggcacgctgacgatcgactacacgggcgtgaccgat
gcgccgacgccgctgaacctgacgaatcacagctacttcaacctgagcggacgcgcgggc
ggcgacgtgcgcggacatctgctgcagatcgacgccgatgcgttcgtcgaagtggacgac
gcgctgatcccgaccggcacggccgacgtgacgggcagcgcgttcgatttccgccagagc
gcgccgatcggcgcgcgcctcgactggccgcatgcgcagctcgcgcgcgggcgcgggttc
gatcactgctacgtgttgcgcgaaccggggggcggcgtgcgcacggttgcgtcgatctac
gatccggagagcgggcgcgagctcgccgtgtcgaccgaccaacgcgggctgcagctttat
acgggcaactatctgcagggcttgcgcgtgagcggcggtgtggtgtgcacgccgcatgcg
gcgctgtgcgtcgaagccgggtactttccggatcaggtcaatatggatgggttgcgcgaa
gagacgattctgcggccggggcaggtttatcggcagacgacgcggtatcgggtgggggtg
cgggggtag

DBGET integrated database retrieval system