KEGG   Burkholderia sp. KJ006: MYA_5854Help
Entry
MYA_5854          CDS       T02110                                 

Definition
Limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
buk  Burkholderia sp. KJ006
Pathway
Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYA_5854
Enzymes [BR:buk01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MYA_5854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(903671..904045)
Genome map
AA seq 124 aa AA seqDB search
MSHDTKTLAEQVVRAFEARDIESMSALLADDVRLEDVPLGAHVGRHAVVEKITDFFGKAS
TYRWEQQRLIAQGSTAIVERTSHIVLGGKEIRLPMVVILEFDANGKLTLFKDYFDLQTLE
RQLA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgatacgaaaaccctcgccgagcaagtcgtccgcgcgttcgaggcgcgcgat
atcgagtcgatgtcggcgctgctcgccgacgacgtgcgcctcgaggacgtaccgctcggc
gcgcatgtcggcaggcatgccgtcgtcgagaagatcaccgacttcttcggcaaggcaagc
acctatcgctgggagcagcagcgcttgatcgcacagggcagcaccgcgatcgtcgagcgc
acgagccatatcgtgctgggcggcaaggagattcggttgccgatggtggtgattctggag
ttcgacgcaaacggcaagttgacgctcttcaaggactatttcgatctgcagacgctggag
cggcaactcgcatga

DBGET integrated database retrieval system