KEGG   Burkholderia sp. KJ006: MYA_5902Help
Entry
MYA_5902          CDS       T02110                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
buk  Burkholderia sp. KJ006
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYA_5902
   00030 Pentose phosphate pathway
    MYA_5902
   00051 Fructose and mannose metabolism
    MYA_5902
   00052 Galactose metabolism
    MYA_5902
   00500 Starch and sucrose metabolism
    MYA_5902
   00520 Amino sugar and nucleotide sugar metabolism
    MYA_5902
  Nucleotide metabolism
   00230 Purine metabolism
    MYA_5902
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYA_5902
Enzymes [BR:buk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MYA_5902
    5.4.2.8  phosphomannomutase
     MYA_5902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(954509..955927)
Genome map
AA seq 472 aa AA seqDB search
MHATERELMISQSIFKAYDIRGVVGKTLDADTARAIGRAFGSEVRAQGGDAVVVARDGRL
SGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALKGGERRVDSCIVVTGSHNP
PDYNGFKMVLRGAAIYGEQIQALYRRIVDERYDTGSGSYEAFDVADQYIARIVGDVKLAR
PLKLVVDAGNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALK
DTDAELGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLA
QWVKEKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLE
ILAKTADPSAVLNALPDAMSTPELQLKLEEGENFRLIEKLQSEAKFDGADEVVTIDGLRV
EYPDGFGLARSSNTTPVVVLRFEAETQEGLERIQADFRRVLTAAKPDVGLPF
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaccgagagagaactgatgatctcccaatccatcttcaaggcatatgacatt
cgcggcgtggtcggcaagacgctcgacgccgacacggcgcgcgccatcggccgcgcgttc
ggcagcgaagtgcgcgcgcaaggcggcgacgccgtcgtggtcgcgcgcgacggccgcctg
tccgggccggaactcgtcggcgcgctggccgatggcctgcgtgcggcgggcgtcgacgtc
gtcgacgtcggcatggtgcccacgccggtcggctatttcgcggcgagcgtgccgctcgcg
ctgaagggcggtgagcgccgcgtcgattcgtgcatcgtcgtcaccggcagccacaacccg
cccgactacaacggcttcaagatggtgctgcgcggcgcggcgatctacggcgagcagatc
caggcgctgtaccgccgcatcgtcgacgagcgctacgacaccggcagcggctcgtacgaa
gcattcgacgtggccgatcagtacatcgcgcgcatcgtcggcgacgtgaagctcgcgcgt
ccgctgaagctcgtcgtcgatgcaggcaacggcgtcgccggtccgctcgccacgcgtctg
ttcaaggcgctcggctgcgagctggtcgagcgcttcaccgacatcgacggcacgttcccg
aaccatcaccccgatcccgcgcacccggaaaacctgcaggacgtgatccaggcgctgaag
gacaccgacgcggaactcggcttcgcgttcgacggcgacggcgaccgcctgggcgtcgtc
acgaaggacggccagatcatctacccggaccgccagctgatgctgttcgcggaggaagtg
ctgtcgcgcaatccgggcgcgcagatcatctacgacgtgaagtgcacgcgccatctcgcg
cagtgggtgaaggagaagggcggcgagccgctgatgtggaagacgggccactcgctggtg
aaggcgaagctgcgcgagaccggcgcgccgctcgcgggcgagatgagcggccacgtgttc
ttcaaggatcgctggtacggcttcgacgacgggctgtacacgggtgcgcggctgcttgag
atcctcgcgaagacggccgatccgagcgcggtgctcaatgcgctgccggatgcgatgagc
acgccggaactgcagctcaagctcgaagaaggcgagaacttccgtctgatcgagaagctg
cagagcgaggcgaagttcgacggcgcggacgaggtcgtgacgatcgacgggctgcgcgtc
gagtatccggacggcttcggcctcgcgcgctcgtcgaacacgacgcccgtggtcgtgctg
cgcttcgaggcggagacgcaggaagggctcgagcgtatccaggcggatttccgccgcgtg
ctgacggctgcgaagccggacgtcggcctgccgttctga

DBGET integrated database retrieval system