KEGG   Burkholderia sp. RPE64: BRPE64_ACDS03190Help
Entry
BRPE64_ACDS03190  CDS       T02684                                 

Gene name
gdhA
Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
buo  Burkholderia sp. RPE64
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buo00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BRPE64_ACDS03190 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRPE64_ACDS03190 (gdhA)
   00330 Arginine and proline metabolism
    BRPE64_ACDS03190 (gdhA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BRPE64_ACDS03190 (gdhA)
Enzymes [BR:buo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     BRPE64_ACDS03190 (gdhA)
Exosome [BR:buo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BRPE64_ACDS03190 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:323314..324627
Genome map
AA seq 437 aa AA seqDB search
MSASKQPAQTPDAKHAIPSYLNADDLGPWGNYLKQVDRVAPYLGSLSRWLETLKRPKRIL
VVDCPIELDNGTVAHFEGYRVQHNTSRGPGKGGVRYHQEVTLSEVMALSAWMSVKNAAVN
VPYGGAKGGIRVDPRTLSRGELERLTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMD
TYSMNQGQTATGVVTGKPISLGGSLGRKEATGRGVFVVATEAARRIGMEIEGARIAVQGF
GNVGGIAAKLFQEAGARVIAVQDHTGTIHNSKGVDAVALLDHVAKTGGVGGFAGADPVQA
DEFWMIESDILIPAALENQITEKNAPKIRTKIVVEGANGPTTTAADDILNDKGILVIPDV
IANAGGVTVSYFEWVQDFSSFFWTEDEINQRLERVMREAFAGVWQVASEQQVSVRTAAFI
VACSRILQAREMRGLYP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcgaagcaacctgcgcaaacgccggacgcaaaacatgccatcccgtcgtac
ctcaacgccgacgatctcggcccctggggcaactatctgaagcaggtcgatcgcgtcgcg
ccgtatctcggttctctctcccgctggctcgaaacgctcaagcgcccgaagcgcattctc
gtcgtcgactgcccgatcgagctggataacggcactgtggcgcacttcgaaggctatcgc
gtgcagcacaacacgtcgcgcggtcccggcaagggcggcgtgcgttaccaccaggaagtg
acgctctccgaagtgatggcgttgtccgcgtggatgtcggtgaagaacgcggcggtgaac
gtgccgtacggcggcgcgaaaggcggcatccgcgtcgatccgcgcacgctctcgcgcggc
gaactcgagcgcctgacgcgccggtatacgagtgaaatcggcatcatcatcgggccgaac
accgacattcccgcgccggacgtgaacaccaacgagcagatcatggcgtggatgatggac
acctactccatgaaccagggccagacggcgaccggcgtggtgaccggcaagccgatctcg
ctcggcggctcgctcggccgcaaggaagcgacgggccgcggcgtgttcgtcgtcgcgacg
gaagcggcgcggcgcatcggcatggagatcgaaggcgcgcgcatcgccgtgcagggcttc
gggaacgtgggcggcatcgcggccaagctgttccaggaagcgggcgcgcgcgtgatcgcc
gtgcaggatcacacgggcacgatccacaactcgaagggcgtcgatgcggtcgcgctgctc
gatcacgtggcgaagaccggcggcgtcggcggtttcgcgggcgcggatccggtgcaggcc
gacgagttctggatgatcgaaagcgacatcctgattccggccgcgctcgaaaaccagatc
acggagaagaacgcgccgaagatccgcacgaagatcgtcgtggaaggcgcaaacggcccg
accacgaccgccgccgacgacatcctgaacgacaagggcatcctcgtcattccggacgtg
atcgcgaacgcgggcggcgtgaccgtctcgtacttcgaatgggtgcaggacttctccagc
ttcttctggacggaagacgagatcaaccagcggctcgagcgcgtaatgcgcgaagcgttc
gccggtgtctggcaggttgcgagcgagcagcaggtttcggtgcgcacggcggcgtttatc
gtcgcgtgttcgcggattctgcaggcgcgcgagatgcgcggtctctatccctga

DBGET integrated database retrieval system